Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0USH5

Protein Details
Accession Q0USH5    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
68-91ILKAVPKKKTSYRKKRQRFMAGKGHydrophilic
130-158NWAIRRPTTKQSKQMKRERRDTELRKRTVHydrophilic
NLS Segment(s)
PositionSequence
73-86PKKKTSYRKKRQRF
Subcellular Location(s) mito 20.5, cyto_mito 11.333, pero 3, cyto_nucl 1.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pno:SNOG_05289  -  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MALARPLPPLWQTLLPAVNGPVRPVLNLPFLQRLAQPFRTLPAPLAAFAIPAIQFPSFPSLGDIWEGILKAVPKKKTSYRKKRQRFMAGKGLKDIIALGRCSACGRVKRSHILCPYCVDAIRTNFFGQLNWAIRRPTTKQSKQMKRERRDTELRKRTVEPDPRQEKAEQILKHTGWKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.24
4 0.23
5 0.24
6 0.22
7 0.21
8 0.2
9 0.19
10 0.19
11 0.2
12 0.21
13 0.21
14 0.23
15 0.25
16 0.25
17 0.26
18 0.26
19 0.26
20 0.29
21 0.31
22 0.31
23 0.31
24 0.27
25 0.28
26 0.29
27 0.28
28 0.23
29 0.21
30 0.19
31 0.17
32 0.18
33 0.16
34 0.13
35 0.13
36 0.13
37 0.08
38 0.08
39 0.09
40 0.07
41 0.07
42 0.08
43 0.12
44 0.11
45 0.11
46 0.12
47 0.11
48 0.12
49 0.12
50 0.11
51 0.08
52 0.08
53 0.08
54 0.06
55 0.07
56 0.08
57 0.12
58 0.17
59 0.19
60 0.21
61 0.25
62 0.34
63 0.44
64 0.54
65 0.62
66 0.67
67 0.76
68 0.84
69 0.87
70 0.88
71 0.88
72 0.84
73 0.78
74 0.78
75 0.71
76 0.62
77 0.55
78 0.46
79 0.35
80 0.28
81 0.21
82 0.13
83 0.1
84 0.1
85 0.09
86 0.08
87 0.09
88 0.09
89 0.12
90 0.14
91 0.18
92 0.22
93 0.28
94 0.31
95 0.39
96 0.41
97 0.46
98 0.5
99 0.47
100 0.44
101 0.41
102 0.39
103 0.33
104 0.31
105 0.25
106 0.22
107 0.22
108 0.23
109 0.22
110 0.2
111 0.21
112 0.21
113 0.19
114 0.17
115 0.2
116 0.23
117 0.23
118 0.25
119 0.23
120 0.24
121 0.29
122 0.31
123 0.35
124 0.41
125 0.46
126 0.54
127 0.64
128 0.74
129 0.79
130 0.85
131 0.86
132 0.85
133 0.87
134 0.84
135 0.82
136 0.82
137 0.82
138 0.83
139 0.82
140 0.78
141 0.73
142 0.69
143 0.66
144 0.65
145 0.66
146 0.63
147 0.64
148 0.66
149 0.64
150 0.64
151 0.59
152 0.53
153 0.51
154 0.51
155 0.41
156 0.4
157 0.46
158 0.43