Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4UD85

Protein Details
Accession G4UD85    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
82-112VGNVKKKKADSKAKKARRKYKKLEEEKAKGGBasic
NLS Segment(s)
PositionSequence
85-110VKKKKADSKAKKARRKYKKLEEEKAK
Subcellular Location(s) nucl 19, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MPPRPKLPEDELEEVYLKGSGPGGQKINKTNSAVQLRHIPTNIVIKCQETRSRTQNRKLAREILAAKVDLFLNGDKSRLAIVGNVKKKKADSKAKKARRKYKKLEEEKAKGGVGQQLVEGAEGEEVEGEDEGEELEGYEEEEVQEGKEAEKGEKAEKHGGNNADGGRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.31
3 0.23
4 0.16
5 0.11
6 0.1
7 0.11
8 0.13
9 0.18
10 0.23
11 0.27
12 0.31
13 0.37
14 0.42
15 0.44
16 0.44
17 0.43
18 0.47
19 0.51
20 0.47
21 0.43
22 0.47
23 0.44
24 0.44
25 0.4
26 0.32
27 0.27
28 0.35
29 0.33
30 0.27
31 0.25
32 0.25
33 0.27
34 0.31
35 0.34
36 0.29
37 0.35
38 0.41
39 0.51
40 0.56
41 0.62
42 0.63
43 0.64
44 0.67
45 0.65
46 0.62
47 0.54
48 0.52
49 0.45
50 0.42
51 0.37
52 0.3
53 0.26
54 0.21
55 0.18
56 0.12
57 0.11
58 0.08
59 0.1
60 0.1
61 0.1
62 0.09
63 0.1
64 0.1
65 0.09
66 0.09
67 0.07
68 0.14
69 0.21
70 0.28
71 0.3
72 0.31
73 0.31
74 0.33
75 0.37
76 0.4
77 0.44
78 0.47
79 0.56
80 0.66
81 0.76
82 0.83
83 0.86
84 0.87
85 0.87
86 0.88
87 0.87
88 0.87
89 0.88
90 0.89
91 0.89
92 0.88
93 0.82
94 0.75
95 0.68
96 0.56
97 0.46
98 0.37
99 0.31
100 0.22
101 0.17
102 0.13
103 0.11
104 0.11
105 0.11
106 0.09
107 0.06
108 0.05
109 0.05
110 0.05
111 0.04
112 0.04
113 0.04
114 0.04
115 0.03
116 0.03
117 0.04
118 0.04
119 0.04
120 0.04
121 0.03
122 0.04
123 0.04
124 0.05
125 0.05
126 0.05
127 0.05
128 0.06
129 0.06
130 0.06
131 0.08
132 0.08
133 0.09
134 0.12
135 0.13
136 0.14
137 0.18
138 0.2
139 0.24
140 0.28
141 0.33
142 0.4
143 0.41
144 0.45
145 0.47
146 0.48
147 0.43
148 0.43