Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4UEZ9

Protein Details
Accession G4UEZ9   
Localization Confidence High
Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
66-88QGAYRLKPKRTIPKKLGAKKTGDHydrophilic
317-342TEKVGSRKAKFRARRRRRNTFLLGIKHydrophilic
345-375KLAKADRREEYRRRVREKREQRLVQRKEFLABasic
NLS Segment(s)
PositionSequence
70-85RLKPKRTIPKKLGAKK
321-442GSRKAKFRARRRRRNTFLLGIKERKLAKADRREEYRRRVREKREQRLVQRKEFLAKQREAKKAREGGAAAEKSEKKEVKAEKPAAAAAAKVEKPKAPEGAKKESKPKVEEKKAAAEPKKDSK
Subcellular Location(s) mito 21, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001684  Ribosomal_L27  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01016  Ribosomal_L27  
Amino Acid Sequences MHLAQLRQPLTRAAANSCHSVCRLPTTHSSVSATAILSEQFAHLRIGPTSSNVAVEGRRYASVKAQGAYRLKPKRTIPKKLGAKKTGDQYVIPGNIIYKQRGTLWHPGENTIMGRDHTIHAAVAGYVKYYRDPQLHPDRQYIGVVFNRNDKLPYPKDAPRKRKLGLVAVPRKVEEVEKPTMSASGLPLFVTRHETIEIPPPAVTTPAAAGKAVKGQGARVSASGAAAVPASSSTISASATSNSNNGGPSVIAELIKEKLAARAEYNARQSALRKLQQQKMLARRGTRVLRLMNNYSYRETNWEIGRLIGDPGSVPGTEKVGSRKAKFRARRRRRNTFLLGIKERKLAKADRREEYRRRVREKREQRLVQRKEFLAKQREAKKAREGGAAAEKSEKKEVKAEKPAAAAAAKVEKPKAPEGAKKESKPKVEEKKAAAEPKKDSKTENKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.39
4 0.37
5 0.36
6 0.33
7 0.34
8 0.31
9 0.32
10 0.32
11 0.31
12 0.37
13 0.43
14 0.44
15 0.44
16 0.46
17 0.38
18 0.38
19 0.34
20 0.27
21 0.2
22 0.18
23 0.15
24 0.12
25 0.12
26 0.11
27 0.1
28 0.11
29 0.12
30 0.13
31 0.15
32 0.15
33 0.17
34 0.16
35 0.18
36 0.2
37 0.19
38 0.18
39 0.17
40 0.18
41 0.16
42 0.18
43 0.18
44 0.17
45 0.19
46 0.2
47 0.2
48 0.25
49 0.31
50 0.33
51 0.31
52 0.32
53 0.37
54 0.4
55 0.44
56 0.48
57 0.49
58 0.49
59 0.55
60 0.61
61 0.65
62 0.7
63 0.75
64 0.73
65 0.74
66 0.82
67 0.84
68 0.86
69 0.82
70 0.78
71 0.73
72 0.73
73 0.69
74 0.6
75 0.5
76 0.43
77 0.43
78 0.37
79 0.32
80 0.24
81 0.18
82 0.22
83 0.24
84 0.23
85 0.18
86 0.18
87 0.2
88 0.25
89 0.29
90 0.33
91 0.35
92 0.39
93 0.38
94 0.39
95 0.37
96 0.34
97 0.3
98 0.23
99 0.19
100 0.14
101 0.14
102 0.14
103 0.14
104 0.14
105 0.13
106 0.11
107 0.1
108 0.1
109 0.09
110 0.09
111 0.07
112 0.07
113 0.08
114 0.08
115 0.09
116 0.12
117 0.17
118 0.2
119 0.21
120 0.3
121 0.4
122 0.47
123 0.49
124 0.5
125 0.47
126 0.44
127 0.44
128 0.35
129 0.28
130 0.25
131 0.26
132 0.23
133 0.26
134 0.26
135 0.26
136 0.26
137 0.24
138 0.28
139 0.27
140 0.32
141 0.32
142 0.37
143 0.48
144 0.56
145 0.64
146 0.64
147 0.68
148 0.64
149 0.63
150 0.6
151 0.57
152 0.54
153 0.55
154 0.56
155 0.52
156 0.52
157 0.47
158 0.44
159 0.36
160 0.31
161 0.24
162 0.21
163 0.22
164 0.21
165 0.21
166 0.21
167 0.21
168 0.19
169 0.16
170 0.11
171 0.09
172 0.09
173 0.08
174 0.09
175 0.09
176 0.09
177 0.14
178 0.13
179 0.12
180 0.13
181 0.14
182 0.14
183 0.22
184 0.22
185 0.17
186 0.17
187 0.16
188 0.15
189 0.15
190 0.14
191 0.06
192 0.07
193 0.08
194 0.08
195 0.08
196 0.08
197 0.08
198 0.1
199 0.11
200 0.11
201 0.09
202 0.1
203 0.12
204 0.13
205 0.13
206 0.11
207 0.11
208 0.1
209 0.09
210 0.09
211 0.06
212 0.05
213 0.04
214 0.04
215 0.03
216 0.03
217 0.04
218 0.03
219 0.04
220 0.04
221 0.04
222 0.05
223 0.06
224 0.06
225 0.07
226 0.08
227 0.08
228 0.08
229 0.09
230 0.09
231 0.09
232 0.08
233 0.07
234 0.06
235 0.06
236 0.07
237 0.07
238 0.06
239 0.06
240 0.07
241 0.08
242 0.08
243 0.08
244 0.07
245 0.1
246 0.12
247 0.12
248 0.12
249 0.17
250 0.21
251 0.24
252 0.27
253 0.25
254 0.24
255 0.24
256 0.25
257 0.27
258 0.32
259 0.32
260 0.37
261 0.44
262 0.49
263 0.54
264 0.58
265 0.58
266 0.59
267 0.62
268 0.57
269 0.51
270 0.48
271 0.49
272 0.47
273 0.43
274 0.39
275 0.36
276 0.37
277 0.4
278 0.41
279 0.4
280 0.4
281 0.39
282 0.37
283 0.34
284 0.29
285 0.29
286 0.28
287 0.27
288 0.24
289 0.24
290 0.22
291 0.21
292 0.21
293 0.17
294 0.15
295 0.1
296 0.09
297 0.07
298 0.07
299 0.08
300 0.07
301 0.08
302 0.08
303 0.1
304 0.11
305 0.12
306 0.16
307 0.23
308 0.29
309 0.31
310 0.38
311 0.45
312 0.54
313 0.62
314 0.69
315 0.72
316 0.78
317 0.86
318 0.88
319 0.91
320 0.89
321 0.88
322 0.85
323 0.82
324 0.79
325 0.77
326 0.75
327 0.68
328 0.63
329 0.59
330 0.53
331 0.46
332 0.44
333 0.42
334 0.44
335 0.5
336 0.55
337 0.57
338 0.64
339 0.71
340 0.74
341 0.77
342 0.78
343 0.77
344 0.79
345 0.81
346 0.83
347 0.85
348 0.87
349 0.88
350 0.88
351 0.87
352 0.88
353 0.9
354 0.88
355 0.85
356 0.81
357 0.73
358 0.69
359 0.67
360 0.65
361 0.63
362 0.61
363 0.61
364 0.63
365 0.7
366 0.69
367 0.67
368 0.67
369 0.66
370 0.63
371 0.6
372 0.52
373 0.47
374 0.52
375 0.47
376 0.39
377 0.4
378 0.38
379 0.36
380 0.44
381 0.4
382 0.33
383 0.4
384 0.48
385 0.5
386 0.58
387 0.6
388 0.55
389 0.55
390 0.54
391 0.48
392 0.4
393 0.31
394 0.24
395 0.26
396 0.24
397 0.26
398 0.28
399 0.28
400 0.32
401 0.36
402 0.41
403 0.4
404 0.46
405 0.5
406 0.58
407 0.65
408 0.67
409 0.72
410 0.72
411 0.74
412 0.72
413 0.76
414 0.76
415 0.77
416 0.79
417 0.74
418 0.76
419 0.76
420 0.79
421 0.76
422 0.72
423 0.7
424 0.72
425 0.74
426 0.67
427 0.65