Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4UIT4

Protein Details
Accession G4UIT4    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MVKKKRRKKKLQTNNNNRGRMIHydrophilic
NLS Segment(s)
PositionSequence
3-10KKKRRKKK
Subcellular Location(s) mito 23.5, mito_nucl 13.833, nucl 3
Family & Domain DBs
Amino Acid Sequences MVKKKRRKKKLQTNNNNRGRMICVPSPICPLLPVRCVLPLKSATKISAMKAMKMSIIISIVCSHLHVCAHIRSSSHIFSFPQVVTDIVLLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.96
2 0.94
3 0.86
4 0.75
5 0.66
6 0.59
7 0.52
8 0.47
9 0.38
10 0.34
11 0.32
12 0.33
13 0.36
14 0.31
15 0.26
16 0.21
17 0.22
18 0.19
19 0.19
20 0.18
21 0.15
22 0.19
23 0.2
24 0.19
25 0.2
26 0.22
27 0.22
28 0.24
29 0.24
30 0.2
31 0.23
32 0.23
33 0.2
34 0.24
35 0.22
36 0.21
37 0.21
38 0.21
39 0.17
40 0.16
41 0.15
42 0.08
43 0.09
44 0.07
45 0.07
46 0.07
47 0.08
48 0.07
49 0.08
50 0.08
51 0.08
52 0.08
53 0.09
54 0.11
55 0.13
56 0.16
57 0.17
58 0.18
59 0.21
60 0.25
61 0.27
62 0.26
63 0.25
64 0.23
65 0.24
66 0.28
67 0.23
68 0.2
69 0.18
70 0.17
71 0.16