Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0U8U6

Protein Details
Accession Q0U8U6   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-37MMLPTRRWYAPQRRRQRQRQRRSNDMPCIEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 7
Family & Domain DBs
KEGG pno:SNOG_11818  -  
Amino Acid Sequences MAGIPTKMMLPTRRWYAPQRRRQRQRQRRSNDMPCIEAPVRPHRGFEALGKIDIKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.48
3 0.54
4 0.61
5 0.66
6 0.71
7 0.76
8 0.83
9 0.9
10 0.92
11 0.92
12 0.93
13 0.93
14 0.89
15 0.88
16 0.87
17 0.84
18 0.82
19 0.72
20 0.64
21 0.54
22 0.53
23 0.43
24 0.35
25 0.31
26 0.31
27 0.37
28 0.34
29 0.35
30 0.31
31 0.33
32 0.33
33 0.34
34 0.35
35 0.29
36 0.32