FuNGI

G4UVZ4

Protein Details

Accession

G4UVZ4

Localization Confidence

Medium

Confidence Score

12.7

NoLS Segment(s)

Position	Sequence	Protein Nature
396-420	IEDEEERRKRKERRDRTRELAREVV	Basic

NLS Segment(s)

Position	Sequence
402-447	RRKRKERRDRTRELAREVVKVPERLRALMKEGKKEAAAREWEMPRR

Subcellular Location(s)

nucl 18.5, cyto_nucl 13.5, cyto 7.5

Family & Domain DBs

InterPro	View protein in InterPro IPR014812 Vps51
Gene Ontology	GO:0005829 C:cytosol GO:0000938 C:GARP complex GO:0007030 P:Golgi organization GO:0006869 P:lipid transport GO:0015031 P:protein transport GO:0042147 P:retrograde transport, endosome to Golgi
Pfam	View protein in Pfam PF08700 Vps51

Amino Acid Sequences

MGKGSVAKVADLLNPAWDLFENLYGYGRCGEGPWGMSGRNRLSAAISGDRQHLRLVRAPRHLIPVPLSSPKSGIAKLPPPAPHRNTQYSGLDRPSHYATDSYPVIDPSPTPQPATHVYTTPPLAAPSRTLDQCQPEHSNMSTIATPRDTGTPLARRVNSSQAFNNSNTTPTSSTRPSLDVPRSASSSPNPSAAPVAAAAGKRANRAALREYYNLKKSQAASGTGTSTPILEVTSTPPSPDPSNNGFQQSLSSFDSIPASPLLDSPDFSAQPYLAELLQSSTLAELLKTYARILSEIRALDAEKKALVYDNYSKLISATETIRKMRTSMFDSNALTGDKLDPMASTLDAVLGKVYELASGIRGELRQRLSESHGGDEDAAVRRRETEQEQDRDLDGIEDEEERRKRKERRDRTRELAREVVKVPERLRALMKEGKKEAAAREWEMPRRLLERWKEKGVGGEDVGRLLEEGDTIVKGEKGSTPSTSTQGVEV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.17
2	0.17
3	0.16
4	0.14
5	0.14
6	0.12
7	0.16
8	0.14
9	0.14
10	0.18
11	0.17
12	0.18
13	0.17
14	0.16
15	0.13
16	0.13
17	0.15
18	0.14
19	0.16
20	0.18
21	0.18
22	0.2
23	0.22
24	0.28
25	0.29
26	0.32
27	0.31
28	0.28
29	0.28
30	0.3
31	0.32
32	0.31
33	0.3
34	0.27
35	0.33
36	0.34
37	0.33
38	0.33
39	0.33
40	0.31
41	0.35
42	0.42
43	0.44
44	0.5
45	0.55
46	0.53
47	0.57
48	0.55
49	0.51
50	0.46
51	0.43
52	0.39
53	0.41
54	0.4
55	0.33
56	0.32
57	0.32
58	0.32
59	0.28
60	0.28
61	0.28
62	0.32
63	0.35
64	0.4
65	0.43
66	0.46
67	0.54
68	0.55
69	0.56
70	0.58
71	0.61
72	0.59
73	0.58
74	0.59
75	0.55
76	0.55
77	0.52
78	0.49
79	0.42
80	0.42
81	0.39
82	0.33
83	0.28
84	0.25
85	0.21
86	0.22
87	0.22
88	0.19
89	0.18
90	0.17
91	0.17
92	0.16
93	0.15
94	0.14
95	0.21
96	0.2
97	0.21
98	0.21
99	0.24
100	0.29
101	0.34
102	0.32
103	0.26
104	0.26
105	0.28
106	0.29
107	0.26
108	0.22
109	0.17
110	0.17
111	0.17
112	0.17
113	0.18
114	0.22
115	0.22
116	0.23
117	0.25
118	0.29
119	0.3
120	0.34
121	0.34
122	0.31
123	0.32
124	0.31
125	0.29
126	0.24
127	0.24
128	0.2
129	0.17
130	0.17
131	0.15
132	0.15
133	0.14
134	0.16
135	0.15
136	0.15
137	0.2
138	0.24
139	0.28
140	0.34
141	0.34
142	0.35
143	0.36
144	0.43
145	0.4
146	0.37
147	0.36
148	0.35
149	0.37
150	0.35
151	0.36
152	0.27
153	0.26
154	0.24
155	0.23
156	0.19
157	0.18
158	0.23
159	0.21
160	0.23
161	0.23
162	0.25
163	0.24
164	0.29
165	0.31
166	0.29
167	0.31
168	0.31
169	0.32
170	0.3
171	0.3
172	0.25
173	0.27
174	0.25
175	0.23
176	0.21
177	0.19
178	0.19
179	0.17
180	0.15
181	0.09
182	0.09
183	0.09
184	0.09
185	0.09
186	0.11
187	0.12
188	0.13
189	0.13
190	0.15
191	0.14
192	0.17
193	0.2
194	0.21
195	0.24
196	0.27
197	0.3
198	0.33
199	0.36
200	0.35
201	0.32
202	0.31
203	0.28
204	0.29
205	0.27
206	0.24
207	0.22
208	0.22
209	0.23
210	0.19
211	0.19
212	0.14
213	0.12
214	0.09
215	0.07
216	0.06
217	0.05
218	0.05
219	0.07
220	0.11
221	0.11
222	0.11
223	0.12
224	0.13
225	0.15
226	0.15
227	0.18
228	0.19
229	0.23
230	0.23
231	0.25
232	0.23
233	0.22
234	0.22
235	0.17
236	0.16
237	0.13
238	0.13
239	0.11
240	0.11
241	0.13
242	0.11
243	0.12
244	0.09
245	0.08
246	0.07
247	0.07
248	0.1
249	0.09
250	0.09
251	0.1
252	0.12
253	0.12
254	0.12
255	0.12
256	0.09
257	0.09
258	0.09
259	0.08
260	0.05
261	0.05
262	0.05
263	0.06
264	0.06
265	0.06
266	0.05
267	0.04
268	0.05
269	0.05
270	0.05
271	0.04
272	0.05
273	0.06
274	0.07
275	0.07
276	0.07
277	0.08
278	0.09
279	0.1
280	0.1
281	0.13
282	0.13
283	0.13
284	0.12
285	0.13
286	0.15
287	0.15
288	0.14
289	0.11
290	0.11
291	0.11
292	0.12
293	0.12
294	0.13
295	0.18
296	0.2
297	0.22
298	0.22
299	0.21
300	0.2
301	0.2
302	0.16
303	0.12
304	0.12
305	0.16
306	0.19
307	0.22
308	0.23
309	0.23
310	0.24
311	0.25
312	0.26
313	0.27
314	0.29
315	0.3
316	0.32
317	0.33
318	0.32
319	0.31
320	0.27
321	0.2
322	0.15
323	0.13
324	0.1
325	0.09
326	0.08
327	0.07
328	0.07
329	0.08
330	0.08
331	0.07
332	0.06
333	0.08
334	0.08
335	0.08
336	0.07
337	0.06
338	0.06
339	0.06
340	0.06
341	0.04
342	0.05
343	0.05
344	0.06
345	0.07
346	0.07
347	0.08
348	0.09
349	0.11
350	0.16
351	0.18
352	0.19
353	0.2
354	0.22
355	0.26
356	0.31
357	0.31
358	0.28
359	0.27
360	0.25
361	0.23
362	0.21
363	0.19
364	0.19
365	0.21
366	0.19
367	0.18
368	0.2
369	0.22
370	0.27
371	0.28
372	0.32
373	0.39
374	0.43
375	0.45
376	0.45
377	0.44
378	0.39
379	0.35
380	0.25
381	0.16
382	0.12
383	0.1
384	0.1
385	0.1
386	0.18
387	0.23
388	0.25
389	0.31
390	0.39
391	0.47
392	0.57
393	0.67
394	0.71
395	0.77
396	0.84
397	0.88
398	0.89
399	0.9
400	0.86
401	0.81
402	0.78
403	0.69
404	0.64
405	0.56
406	0.54
407	0.48
408	0.47
409	0.41
410	0.4
411	0.39
412	0.37
413	0.4
414	0.35
415	0.36
416	0.4
417	0.44
418	0.45
419	0.46
420	0.46
421	0.44
422	0.45
423	0.43
424	0.43
425	0.43
426	0.38
427	0.43
428	0.47
429	0.51
430	0.51
431	0.49
432	0.44
433	0.43
434	0.44
435	0.45
436	0.48
437	0.51
438	0.55
439	0.6
440	0.58
441	0.56
442	0.59
443	0.54
444	0.48
445	0.4
446	0.37
447	0.31
448	0.29
449	0.28
450	0.21
451	0.17
452	0.13
453	0.11
454	0.06
455	0.07
456	0.07
457	0.08
458	0.08
459	0.1
460	0.1
461	0.1
462	0.12
463	0.16
464	0.18
465	0.22
466	0.24
467	0.28
468	0.29
469	0.33
470	0.34

G4UVZ4

3D AlphaFold-predicted Structure Viewer