Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4UVK3

Protein Details
Accession G4UVK3    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
44-69RQISIPPPQKREKKRNKVDISRHTRIHydrophilic
NLS Segment(s)
PositionSequence
53-59KREKKRN
Subcellular Location(s) nucl 17, mito_nucl 12.833, cyto_nucl 9.333, mito 7.5
Family & Domain DBs
Amino Acid Sequences MLKSSRWKGLQTGCNDIYFRLKLHARNEEPTTLPLYLTNHATHRQISIPPPQKREKKRNKVDISRHTRIRLWYEFLKLRIAVEVSQLCGNTYSGIEQLFAFVDEHATARDRHRNNQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.47
3 0.41
4 0.37
5 0.31
6 0.27
7 0.25
8 0.27
9 0.3
10 0.37
11 0.45
12 0.43
13 0.47
14 0.49
15 0.46
16 0.43
17 0.39
18 0.35
19 0.26
20 0.22
21 0.19
22 0.18
23 0.17
24 0.18
25 0.18
26 0.17
27 0.19
28 0.2
29 0.19
30 0.18
31 0.18
32 0.18
33 0.2
34 0.27
35 0.35
36 0.38
37 0.43
38 0.5
39 0.57
40 0.64
41 0.72
42 0.74
43 0.75
44 0.8
45 0.85
46 0.85
47 0.86
48 0.86
49 0.86
50 0.84
51 0.79
52 0.73
53 0.64
54 0.58
55 0.52
56 0.49
57 0.4
58 0.36
59 0.32
60 0.34
61 0.35
62 0.33
63 0.32
64 0.26
65 0.24
66 0.21
67 0.19
68 0.14
69 0.15
70 0.15
71 0.14
72 0.15
73 0.15
74 0.14
75 0.14
76 0.14
77 0.1
78 0.1
79 0.09
80 0.09
81 0.09
82 0.1
83 0.08
84 0.09
85 0.08
86 0.09
87 0.08
88 0.07
89 0.09
90 0.08
91 0.09
92 0.1
93 0.11
94 0.13
95 0.19
96 0.29
97 0.32