Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4UAY6

Protein Details
Accession G4UAY6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-25TTIAKFHKARKWAKKEGCRGGVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MGATTIAKFHKARKWAKKEGCRGGVVGVIDDEGGTSIEDRYGGCGVLIALCCETRTENGGQARRQRQPRKNNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.71
3 0.79
4 0.82
5 0.85
6 0.85
7 0.8
8 0.7
9 0.61
10 0.51
11 0.43
12 0.33
13 0.23
14 0.14
15 0.09
16 0.08
17 0.07
18 0.06
19 0.03
20 0.04
21 0.03
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.06
28 0.06
29 0.06
30 0.05
31 0.05
32 0.05
33 0.07
34 0.07
35 0.06
36 0.07
37 0.07
38 0.07
39 0.08
40 0.09
41 0.09
42 0.12
43 0.13
44 0.19
45 0.26
46 0.32
47 0.37
48 0.45
49 0.52
50 0.58
51 0.67
52 0.71
53 0.74