Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4UDS0

Protein Details
Accession G4UDS0    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
30-49VTKVKKNKTKADKVQKKFTAHydrophilic
NLS Segment(s)
PositionSequence
13-89NPGLNRSKGGKAPKKSGVTKVKKNKTKADKVQKKFTAGMAAKTEKMLGARAGHLELIGKGKKEENKEKFKGGTRKFG
Subcellular Location(s) mito 17, nucl 8.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGSGSKITKPNPGLNRSKGGKAPKKSGVTKVKKNKTKADKVQKKFTAGMAAKTEKMLGARAGHLELIGKGKKEENKEKFKGGTRKFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.58
3 0.58
4 0.64
5 0.59
6 0.58
7 0.55
8 0.58
9 0.59
10 0.57
11 0.59
12 0.59
13 0.63
14 0.62
15 0.66
16 0.67
17 0.67
18 0.71
19 0.74
20 0.76
21 0.76
22 0.78
23 0.78
24 0.76
25 0.78
26 0.78
27 0.79
28 0.79
29 0.77
30 0.82
31 0.75
32 0.68
33 0.59
34 0.49
35 0.47
36 0.37
37 0.35
38 0.29
39 0.28
40 0.26
41 0.24
42 0.24
43 0.15
44 0.15
45 0.13
46 0.11
47 0.1
48 0.11
49 0.12
50 0.13
51 0.12
52 0.11
53 0.11
54 0.1
55 0.15
56 0.15
57 0.15
58 0.16
59 0.22
60 0.27
61 0.36
62 0.45
63 0.49
64 0.57
65 0.61
66 0.66
67 0.67
68 0.71
69 0.72