Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UB40

Protein Details
Accession Q0UB40    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
217-244IQANEEKKKLRNSSKKGGKSKKEAKRGRBasic
NLS Segment(s)
PositionSequence
211-244RKSRARIQANEEKKKLRNSSKKGGKSKKEAKRGR
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001684  Ribosomal_L27  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pno:SNOG_11024  -  
Pfam View protein in Pfam  
PF01016  Ribosomal_L27  
Amino Acid Sequences MLLPRILAPVRASISASSKIIAPSKSVLEALRAANGTTAPFATTILPFVRYASHQSQGRANGAKDGPGKRLGAKKSGAWFPGENCKFGRDHCIFATESGYVRYYKDPNRHPDRQFIGVALEKHHSLPYPLTAPRQRRLNMVAVERTVESGDQLLATTTPDTTSPRDKSGRILTMGKGYAFREQNWQIGRSAERAGVKFDEFVPGDRWAAWRKSRARIQANEEKKKLRNSSKKGGKSKKEAKRGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.25
4 0.21
5 0.2
6 0.23
7 0.26
8 0.25
9 0.23
10 0.22
11 0.23
12 0.24
13 0.24
14 0.21
15 0.19
16 0.22
17 0.2
18 0.21
19 0.19
20 0.18
21 0.17
22 0.17
23 0.15
24 0.12
25 0.11
26 0.08
27 0.08
28 0.09
29 0.1
30 0.09
31 0.11
32 0.11
33 0.13
34 0.12
35 0.13
36 0.14
37 0.14
38 0.21
39 0.22
40 0.28
41 0.29
42 0.31
43 0.35
44 0.37
45 0.4
46 0.37
47 0.34
48 0.33
49 0.3
50 0.33
51 0.34
52 0.33
53 0.31
54 0.3
55 0.31
56 0.3
57 0.37
58 0.35
59 0.34
60 0.34
61 0.35
62 0.37
63 0.4
64 0.36
65 0.32
66 0.31
67 0.27
68 0.36
69 0.33
70 0.29
71 0.26
72 0.27
73 0.24
74 0.24
75 0.3
76 0.21
77 0.23
78 0.22
79 0.24
80 0.23
81 0.23
82 0.23
83 0.15
84 0.14
85 0.12
86 0.13
87 0.1
88 0.11
89 0.14
90 0.17
91 0.22
92 0.3
93 0.35
94 0.43
95 0.51
96 0.58
97 0.57
98 0.6
99 0.58
100 0.53
101 0.47
102 0.38
103 0.32
104 0.26
105 0.24
106 0.18
107 0.16
108 0.13
109 0.13
110 0.13
111 0.11
112 0.09
113 0.09
114 0.09
115 0.12
116 0.13
117 0.18
118 0.23
119 0.28
120 0.32
121 0.38
122 0.37
123 0.37
124 0.39
125 0.4
126 0.38
127 0.37
128 0.33
129 0.27
130 0.27
131 0.24
132 0.21
133 0.15
134 0.11
135 0.07
136 0.06
137 0.06
138 0.05
139 0.05
140 0.04
141 0.04
142 0.05
143 0.05
144 0.05
145 0.05
146 0.06
147 0.09
148 0.12
149 0.19
150 0.21
151 0.26
152 0.29
153 0.29
154 0.34
155 0.39
156 0.4
157 0.36
158 0.36
159 0.32
160 0.34
161 0.34
162 0.29
163 0.24
164 0.21
165 0.25
166 0.24
167 0.23
168 0.27
169 0.28
170 0.33
171 0.34
172 0.34
173 0.28
174 0.29
175 0.3
176 0.24
177 0.24
178 0.22
179 0.23
180 0.22
181 0.25
182 0.24
183 0.23
184 0.22
185 0.2
186 0.22
187 0.19
188 0.21
189 0.21
190 0.2
191 0.2
192 0.2
193 0.23
194 0.23
195 0.29
196 0.32
197 0.38
198 0.43
199 0.51
200 0.58
201 0.65
202 0.68
203 0.69
204 0.72
205 0.74
206 0.78
207 0.79
208 0.77
209 0.74
210 0.71
211 0.73
212 0.74
213 0.75
214 0.75
215 0.74
216 0.8
217 0.83
218 0.87
219 0.89
220 0.9
221 0.88
222 0.88
223 0.9
224 0.89