Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4UBB6

Protein Details
Accession G4UBB6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
91-110EKVMRDTKKKEKNMDTRVLVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003545  Telomerase_RT  
Gene Ontology GO:0000781  C:chromosome, telomeric region  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
GO:0003721  F:telomerase RNA reverse transcriptase activity  
Amino Acid Sequences MWAHARCLSSTTTQRKRKPGTALVIDTIKSLIEVAYRLLTSKSRKERYPGYQCSVSKGQVAWLAMVACRQVLVRKQAGYREVIRWLEGEIEKVMRDTKKKEKNMDTRVLVEVAREGVYTKVECKKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.73
3 0.78
4 0.77
5 0.77
6 0.74
7 0.73
8 0.7
9 0.66
10 0.59
11 0.53
12 0.46
13 0.38
14 0.29
15 0.2
16 0.13
17 0.1
18 0.07
19 0.06
20 0.06
21 0.07
22 0.08
23 0.08
24 0.09
25 0.1
26 0.14
27 0.18
28 0.27
29 0.35
30 0.39
31 0.41
32 0.46
33 0.52
34 0.58
35 0.63
36 0.6
37 0.56
38 0.58
39 0.56
40 0.56
41 0.51
42 0.42
43 0.33
44 0.27
45 0.23
46 0.18
47 0.18
48 0.12
49 0.1
50 0.1
51 0.08
52 0.09
53 0.07
54 0.05
55 0.05
56 0.05
57 0.06
58 0.1
59 0.14
60 0.17
61 0.19
62 0.21
63 0.24
64 0.26
65 0.27
66 0.27
67 0.24
68 0.26
69 0.25
70 0.24
71 0.21
72 0.19
73 0.2
74 0.17
75 0.17
76 0.13
77 0.13
78 0.13
79 0.13
80 0.17
81 0.17
82 0.22
83 0.27
84 0.37
85 0.46
86 0.53
87 0.62
88 0.68
89 0.75
90 0.79
91 0.81
92 0.74
93 0.67
94 0.61
95 0.53
96 0.43
97 0.33
98 0.25
99 0.18
100 0.15
101 0.12
102 0.11
103 0.1
104 0.14
105 0.14
106 0.19