Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4UZG0

Protein Details
Accession G4UZG0    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
58-85APDPNKKKDEDNKQQDKKEKDQKKDQKKBasic
NLS Segment(s)
PositionSequence
70-85KQQDKKEKDQKKDQKK
Subcellular Location(s) nucl 26
Family & Domain DBs
Amino Acid Sequences MFPLLSPNQLRQRTIQDSKKNIITTQSYLEPVLHYLHPRSKMPEKKLTPNFTVRRMTAPDPNKKKDEDNKQQDKKEKDQKKDQKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.6
3 0.59
4 0.62
5 0.65
6 0.66
7 0.59
8 0.51
9 0.47
10 0.41
11 0.34
12 0.32
13 0.29
14 0.24
15 0.23
16 0.22
17 0.18
18 0.15
19 0.15
20 0.13
21 0.12
22 0.14
23 0.18
24 0.2
25 0.21
26 0.25
27 0.32
28 0.38
29 0.43
30 0.5
31 0.49
32 0.56
33 0.63
34 0.63
35 0.58
36 0.6
37 0.57
38 0.53
39 0.53
40 0.44
41 0.4
42 0.4
43 0.39
44 0.38
45 0.42
46 0.47
47 0.52
48 0.57
49 0.56
50 0.55
51 0.6
52 0.61
53 0.64
54 0.65
55 0.68
56 0.73
57 0.78
58 0.84
59 0.84
60 0.82
61 0.82
62 0.81
63 0.8
64 0.78
65 0.81