Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4V0X0

Protein Details
Accession G4V0X0   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
60-84PEEFKKRQARWMKPNRKQREKESPDBasic
NLS Segment(s)
PositionSequence
64-93KKRQARWMKPNRKQREKESPDEKKKERMEK
Subcellular Location(s) nucl 16, mito 6, cyto 4
Family & Domain DBs
Amino Acid Sequences MSNHWEKAVHNLETGLSGLCGTHSHGSSTPGRQQAHGNRNGASTDATGRSGRERIENETPEEFKKRQARWMKPNRKQREKESPDEKKKERMEKAEHRQDGEVRHNLVAHATPSTLRRSGTETWRGTSWRSQHPPPPGADAAHRANNDAPPPRHRVQDGGEPAAEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.16
3 0.1
4 0.08
5 0.07
6 0.07
7 0.07
8 0.1
9 0.13
10 0.13
11 0.16
12 0.17
13 0.21
14 0.25
15 0.3
16 0.33
17 0.36
18 0.36
19 0.35
20 0.43
21 0.48
22 0.53
23 0.55
24 0.5
25 0.44
26 0.45
27 0.43
28 0.36
29 0.27
30 0.18
31 0.15
32 0.14
33 0.15
34 0.14
35 0.15
36 0.17
37 0.18
38 0.18
39 0.2
40 0.21
41 0.25
42 0.32
43 0.33
44 0.34
45 0.35
46 0.36
47 0.33
48 0.36
49 0.3
50 0.3
51 0.37
52 0.35
53 0.41
54 0.49
55 0.55
56 0.61
57 0.72
58 0.75
59 0.76
60 0.86
61 0.87
62 0.87
63 0.84
64 0.81
65 0.81
66 0.76
67 0.76
68 0.76
69 0.76
70 0.75
71 0.77
72 0.71
73 0.68
74 0.68
75 0.68
76 0.63
77 0.6
78 0.6
79 0.62
80 0.7
81 0.71
82 0.66
83 0.59
84 0.55
85 0.5
86 0.46
87 0.42
88 0.35
89 0.27
90 0.26
91 0.25
92 0.23
93 0.22
94 0.18
95 0.12
96 0.09
97 0.08
98 0.09
99 0.11
100 0.14
101 0.15
102 0.15
103 0.15
104 0.2
105 0.25
106 0.31
107 0.38
108 0.36
109 0.37
110 0.39
111 0.39
112 0.37
113 0.38
114 0.37
115 0.38
116 0.42
117 0.45
118 0.5
119 0.57
120 0.58
121 0.54
122 0.54
123 0.46
124 0.41
125 0.39
126 0.38
127 0.35
128 0.36
129 0.34
130 0.3
131 0.31
132 0.33
133 0.36
134 0.39
135 0.39
136 0.38
137 0.46
138 0.47
139 0.5
140 0.48
141 0.47
142 0.43
143 0.49
144 0.5
145 0.46