Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4UPG6

Protein Details
Accession G4UPG6    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MNWTPHPPLPRRREERNKVEENVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 12.333, mito_nucl 10.499, cyto 4.5, mito 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000421  FA58C  
PROSITE View protein in PROSITE  
PS50022  FA58C_3  
Amino Acid Sequences MNWTPHPPLPRRREERNKVEENVDNELKVFAMSVLGSTSSDRYFLSTSGDGAYKSLLLWV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.85
3 0.84
4 0.81
5 0.72
6 0.7
7 0.64
8 0.56
9 0.52
10 0.42
11 0.32
12 0.26
13 0.23
14 0.19
15 0.14
16 0.1
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.05
24 0.05
25 0.07
26 0.07
27 0.08
28 0.08
29 0.1
30 0.11
31 0.11
32 0.15
33 0.14
34 0.15
35 0.16
36 0.17
37 0.15
38 0.14
39 0.15
40 0.1