Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0TXI7

Protein Details
Accession Q0TXI7    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
59-111AEEPKISKNQLKKKRRLEQWEAGREDRKVKRKEKAKERKERKRETWKEQNTDEBasic
NLS Segment(s)
PositionSequence
66-101KNQLKKKRRLEQWEAGREDRKVKRKEKAKERKERKR
Subcellular Location(s) nucl 17, cyto 6, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR028564  MT_TRM10-typ  
IPR038459  MT_TRM10-typ_sf  
IPR007356  tRNA_m1G_MeTrfase_euk  
IPR016009  tRNA_MeTrfase_TRMD/TRM10  
Gene Ontology GO:0005634  C:nucleus  
GO:0052905  F:tRNA (guanine(9)-N(1))-methyltransferase activity  
GO:0009019  F:tRNA (guanine-N1-)-methyltransferase activity  
GO:0000049  F:tRNA binding  
GO:0002939  P:tRNA N1-guanine methylation  
KEGG pno:SNOG_15740  -  
Pfam View protein in Pfam  
PF01746  tRNA_m1G_MT  
PROSITE View protein in PROSITE  
PS51675  SAM_MT_TRM10  
CDD cd18089  SPOUT_Trm10-like  
Amino Acid Sequences MESEERPAKMRKLEHEENADIILNDEVPTTTATVDESNPVTTESSDTVAATGETPVANAEEPKISKNQLKKKRRLEQWEAGREDRKVKRKEKAKERKERKRETWKEQNTDENGNVLPMPPSRLPRHFSGFGAQVPITIIFDCDFEDLMYDAELKSLGLQITRCYSDNRKAKYKTHLALSSFGGKMKERFDGILAKQYTNWKGFRFFEEDFVAVAEKAKEWMVAPNDDEDIGALRRPSEGSAEGKEPQAGDADEEGEIVYLSAESDNVLTHLKPNSTYIIGGLVDKNRHKGICHKRAVNRNIKTAKLPIGEYLEMRDRKVLVTNHVLEILLKWMEYDDWGKAFMEVMPKRKGFKLREDGEREEAESNTGTQNGDEQDEQEMEDAAKEAVEEAEGTTNVPETEIIETTKGLPVGETAAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.68
3 0.64
4 0.57
5 0.52
6 0.44
7 0.34
8 0.27
9 0.2
10 0.13
11 0.11
12 0.1
13 0.09
14 0.08
15 0.09
16 0.09
17 0.08
18 0.08
19 0.09
20 0.11
21 0.11
22 0.14
23 0.15
24 0.15
25 0.15
26 0.16
27 0.16
28 0.14
29 0.16
30 0.14
31 0.14
32 0.14
33 0.14
34 0.13
35 0.12
36 0.12
37 0.1
38 0.09
39 0.08
40 0.07
41 0.07
42 0.08
43 0.09
44 0.09
45 0.09
46 0.1
47 0.14
48 0.16
49 0.18
50 0.21
51 0.25
52 0.3
53 0.39
54 0.48
55 0.54
56 0.64
57 0.72
58 0.79
59 0.85
60 0.88
61 0.89
62 0.88
63 0.87
64 0.87
65 0.86
66 0.8
67 0.74
68 0.68
69 0.6
70 0.6
71 0.59
72 0.58
73 0.58
74 0.61
75 0.65
76 0.71
77 0.79
78 0.82
79 0.84
80 0.85
81 0.87
82 0.91
83 0.93
84 0.94
85 0.94
86 0.93
87 0.93
88 0.92
89 0.9
90 0.9
91 0.89
92 0.85
93 0.78
94 0.76
95 0.68
96 0.62
97 0.53
98 0.43
99 0.34
100 0.27
101 0.23
102 0.16
103 0.13
104 0.1
105 0.14
106 0.15
107 0.21
108 0.26
109 0.3
110 0.34
111 0.36
112 0.42
113 0.4
114 0.38
115 0.37
116 0.34
117 0.3
118 0.29
119 0.25
120 0.18
121 0.16
122 0.16
123 0.12
124 0.09
125 0.09
126 0.06
127 0.07
128 0.07
129 0.07
130 0.07
131 0.06
132 0.07
133 0.06
134 0.06
135 0.06
136 0.06
137 0.05
138 0.05
139 0.05
140 0.04
141 0.05
142 0.06
143 0.06
144 0.07
145 0.08
146 0.09
147 0.12
148 0.14
149 0.14
150 0.16
151 0.21
152 0.29
153 0.36
154 0.4
155 0.46
156 0.49
157 0.54
158 0.58
159 0.62
160 0.56
161 0.55
162 0.54
163 0.47
164 0.44
165 0.41
166 0.37
167 0.29
168 0.27
169 0.22
170 0.18
171 0.19
172 0.18
173 0.18
174 0.14
175 0.14
176 0.14
177 0.18
178 0.18
179 0.24
180 0.23
181 0.22
182 0.23
183 0.27
184 0.29
185 0.28
186 0.29
187 0.22
188 0.25
189 0.26
190 0.27
191 0.28
192 0.25
193 0.25
194 0.24
195 0.23
196 0.19
197 0.18
198 0.15
199 0.09
200 0.1
201 0.07
202 0.05
203 0.06
204 0.06
205 0.06
206 0.06
207 0.1
208 0.11
209 0.12
210 0.13
211 0.13
212 0.13
213 0.13
214 0.12
215 0.08
216 0.08
217 0.07
218 0.07
219 0.06
220 0.06
221 0.06
222 0.07
223 0.08
224 0.08
225 0.1
226 0.12
227 0.14
228 0.16
229 0.17
230 0.17
231 0.17
232 0.15
233 0.13
234 0.12
235 0.1
236 0.09
237 0.08
238 0.08
239 0.07
240 0.07
241 0.07
242 0.05
243 0.05
244 0.04
245 0.04
246 0.03
247 0.03
248 0.03
249 0.03
250 0.03
251 0.04
252 0.04
253 0.05
254 0.06
255 0.06
256 0.09
257 0.11
258 0.12
259 0.12
260 0.14
261 0.16
262 0.15
263 0.15
264 0.13
265 0.13
266 0.12
267 0.13
268 0.13
269 0.14
270 0.18
271 0.19
272 0.23
273 0.23
274 0.24
275 0.24
276 0.33
277 0.41
278 0.46
279 0.53
280 0.57
281 0.62
282 0.71
283 0.79
284 0.79
285 0.73
286 0.72
287 0.68
288 0.63
289 0.58
290 0.52
291 0.48
292 0.4
293 0.37
294 0.3
295 0.3
296 0.29
297 0.26
298 0.26
299 0.28
300 0.27
301 0.27
302 0.26
303 0.22
304 0.22
305 0.28
306 0.27
307 0.24
308 0.31
309 0.33
310 0.31
311 0.31
312 0.3
313 0.24
314 0.22
315 0.19
316 0.12
317 0.09
318 0.08
319 0.08
320 0.09
321 0.11
322 0.12
323 0.11
324 0.11
325 0.13
326 0.13
327 0.13
328 0.13
329 0.13
330 0.2
331 0.23
332 0.28
333 0.34
334 0.36
335 0.4
336 0.45
337 0.52
338 0.48
339 0.55
340 0.59
341 0.59
342 0.67
343 0.7
344 0.69
345 0.66
346 0.61
347 0.53
348 0.44
349 0.38
350 0.3
351 0.24
352 0.2
353 0.16
354 0.16
355 0.14
356 0.12
357 0.15
358 0.15
359 0.17
360 0.16
361 0.16
362 0.17
363 0.18
364 0.18
365 0.15
366 0.14
367 0.11
368 0.11
369 0.11
370 0.08
371 0.07
372 0.07
373 0.07
374 0.06
375 0.07
376 0.07
377 0.07
378 0.1
379 0.1
380 0.11
381 0.1
382 0.11
383 0.11
384 0.11
385 0.1
386 0.09
387 0.12
388 0.13
389 0.14
390 0.14
391 0.15
392 0.16
393 0.19
394 0.18
395 0.15
396 0.14
397 0.13