Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4UHE3

Protein Details
Accession G4UHE3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
308-332DWTPEHRRVKGQKRKHRGHVDPEIYBasic
NLS Segment(s)
PositionSequence
314-324RRVKGQKRKHR
Subcellular Location(s) extr 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR006076  FAD-dep_OxRdtase  
IPR036188  FAD/NAD-bd_sf  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF01266  DAO  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MAAQQQKRNIVIVGGGIIGCTTAYFLTRHPKFDPAQHTITLLEASSIAAGASGKAGGLLALWAYPECLVPLSYRLHRELADEHNGAERWGYRQVGCGTIGAVVKNTDLKARGQGTSASTTSDLKEPNGTTAAAPNAHLPIQAEDEKISKDWEKLPKQDVAATSLLSKSVLPPDLDWVDASLVRSWDVMGRRGETETAQAHPFHFTNAMADLAAAKGVDIRLGAKVTNITSSSSSAPNGRVDTVEYQDRNNNDEIKSITGVTDVILTAGPWTGKILPRSKIEGLRAHSVVYEAEVSPYAVFTDIELPSDWTPEHRRVKGQKRKHRGHVDPEIYARPFGEVYACGEPDKTIPLPETADQVQCDEDQCNDLISYIATVSPILASAPVKAKQACYLPQHVRFGEERGPLIGQTSTPGLWIAAGHTCWGIQNGPATGLLMSELIFDGQTKSADIDKLDPKKFKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.09
4 0.08
5 0.07
6 0.06
7 0.05
8 0.05
9 0.05
10 0.07
11 0.08
12 0.12
13 0.23
14 0.26
15 0.31
16 0.32
17 0.39
18 0.41
19 0.48
20 0.53
21 0.49
22 0.5
23 0.47
24 0.46
25 0.39
26 0.37
27 0.29
28 0.2
29 0.14
30 0.09
31 0.09
32 0.07
33 0.07
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.05
49 0.05
50 0.05
51 0.06
52 0.06
53 0.06
54 0.07
55 0.08
56 0.09
57 0.13
58 0.18
59 0.22
60 0.26
61 0.28
62 0.29
63 0.29
64 0.31
65 0.32
66 0.33
67 0.35
68 0.32
69 0.3
70 0.32
71 0.31
72 0.28
73 0.25
74 0.2
75 0.15
76 0.19
77 0.21
78 0.17
79 0.23
80 0.24
81 0.25
82 0.25
83 0.22
84 0.18
85 0.19
86 0.2
87 0.14
88 0.13
89 0.11
90 0.12
91 0.14
92 0.14
93 0.14
94 0.14
95 0.15
96 0.21
97 0.24
98 0.24
99 0.22
100 0.24
101 0.24
102 0.27
103 0.26
104 0.21
105 0.19
106 0.19
107 0.2
108 0.21
109 0.19
110 0.16
111 0.2
112 0.19
113 0.2
114 0.2
115 0.19
116 0.15
117 0.17
118 0.18
119 0.15
120 0.15
121 0.14
122 0.14
123 0.13
124 0.13
125 0.12
126 0.11
127 0.15
128 0.16
129 0.15
130 0.15
131 0.16
132 0.16
133 0.16
134 0.17
135 0.15
136 0.16
137 0.22
138 0.3
139 0.35
140 0.39
141 0.42
142 0.43
143 0.42
144 0.43
145 0.37
146 0.32
147 0.27
148 0.22
149 0.19
150 0.16
151 0.15
152 0.12
153 0.11
154 0.08
155 0.11
156 0.12
157 0.12
158 0.12
159 0.16
160 0.16
161 0.16
162 0.15
163 0.12
164 0.11
165 0.11
166 0.12
167 0.09
168 0.08
169 0.08
170 0.09
171 0.08
172 0.11
173 0.12
174 0.15
175 0.15
176 0.17
177 0.17
178 0.18
179 0.18
180 0.15
181 0.17
182 0.14
183 0.15
184 0.15
185 0.15
186 0.15
187 0.16
188 0.16
189 0.13
190 0.12
191 0.1
192 0.1
193 0.1
194 0.09
195 0.07
196 0.07
197 0.06
198 0.05
199 0.05
200 0.04
201 0.03
202 0.03
203 0.03
204 0.04
205 0.04
206 0.04
207 0.05
208 0.06
209 0.06
210 0.06
211 0.07
212 0.07
213 0.09
214 0.09
215 0.09
216 0.09
217 0.11
218 0.12
219 0.12
220 0.12
221 0.12
222 0.13
223 0.14
224 0.14
225 0.13
226 0.11
227 0.12
228 0.13
229 0.14
230 0.17
231 0.16
232 0.17
233 0.19
234 0.2
235 0.21
236 0.21
237 0.21
238 0.17
239 0.18
240 0.18
241 0.16
242 0.16
243 0.14
244 0.12
245 0.09
246 0.09
247 0.07
248 0.07
249 0.05
250 0.05
251 0.04
252 0.04
253 0.04
254 0.05
255 0.05
256 0.04
257 0.06
258 0.08
259 0.11
260 0.16
261 0.21
262 0.24
263 0.27
264 0.32
265 0.34
266 0.36
267 0.38
268 0.38
269 0.37
270 0.38
271 0.36
272 0.31
273 0.27
274 0.24
275 0.19
276 0.14
277 0.12
278 0.07
279 0.07
280 0.07
281 0.08
282 0.07
283 0.07
284 0.06
285 0.05
286 0.05
287 0.05
288 0.1
289 0.09
290 0.11
291 0.11
292 0.13
293 0.13
294 0.14
295 0.13
296 0.13
297 0.18
298 0.26
299 0.33
300 0.33
301 0.41
302 0.5
303 0.62
304 0.68
305 0.74
306 0.76
307 0.79
308 0.86
309 0.88
310 0.88
311 0.85
312 0.84
313 0.83
314 0.77
315 0.69
316 0.63
317 0.57
318 0.47
319 0.4
320 0.3
321 0.21
322 0.17
323 0.14
324 0.12
325 0.09
326 0.12
327 0.15
328 0.15
329 0.14
330 0.14
331 0.15
332 0.14
333 0.17
334 0.14
335 0.12
336 0.13
337 0.15
338 0.17
339 0.18
340 0.21
341 0.19
342 0.21
343 0.2
344 0.2
345 0.19
346 0.17
347 0.18
348 0.14
349 0.13
350 0.13
351 0.12
352 0.12
353 0.11
354 0.1
355 0.09
356 0.08
357 0.08
358 0.07
359 0.07
360 0.06
361 0.06
362 0.06
363 0.05
364 0.05
365 0.05
366 0.06
367 0.07
368 0.1
369 0.15
370 0.17
371 0.21
372 0.22
373 0.24
374 0.27
375 0.32
376 0.35
377 0.36
378 0.43
379 0.47
380 0.52
381 0.57
382 0.53
383 0.52
384 0.46
385 0.45
386 0.43
387 0.38
388 0.32
389 0.28
390 0.28
391 0.24
392 0.24
393 0.2
394 0.14
395 0.13
396 0.14
397 0.12
398 0.11
399 0.12
400 0.1
401 0.1
402 0.1
403 0.1
404 0.11
405 0.11
406 0.12
407 0.12
408 0.12
409 0.13
410 0.14
411 0.13
412 0.12
413 0.15
414 0.15
415 0.16
416 0.16
417 0.16
418 0.14
419 0.13
420 0.12
421 0.08
422 0.07
423 0.07
424 0.07
425 0.07
426 0.07
427 0.08
428 0.09
429 0.11
430 0.11
431 0.11
432 0.13
433 0.16
434 0.18
435 0.19
436 0.25
437 0.32
438 0.41
439 0.48