Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4U830

Protein Details
Accession G4U830    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
16-41TDGSSVDSRGRRRRRNKGALQKQGGLHydrophilic
NLS Segment(s)
PositionSequence
24-33RGRRRRRNKG
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MSNANPTMPKLDDNNTDGSSVDSRGRRRRRNKGALQKQGGLAGPQTLPRLADTKPVRLQLGLNLDVELELKARLQGDVSLTLLNDPHLPPNFTSTPLPTPSPSTNSSISGLARSACVSAGSTTMSALA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.31
4 0.28
5 0.27
6 0.22
7 0.19
8 0.22
9 0.23
10 0.3
11 0.4
12 0.5
13 0.58
14 0.67
15 0.76
16 0.81
17 0.87
18 0.9
19 0.91
20 0.91
21 0.91
22 0.86
23 0.77
24 0.67
25 0.59
26 0.48
27 0.37
28 0.27
29 0.18
30 0.13
31 0.12
32 0.12
33 0.1
34 0.1
35 0.11
36 0.12
37 0.11
38 0.19
39 0.2
40 0.25
41 0.28
42 0.29
43 0.29
44 0.27
45 0.27
46 0.22
47 0.25
48 0.2
49 0.16
50 0.15
51 0.14
52 0.13
53 0.13
54 0.09
55 0.05
56 0.04
57 0.04
58 0.05
59 0.05
60 0.05
61 0.05
62 0.06
63 0.07
64 0.08
65 0.09
66 0.08
67 0.08
68 0.08
69 0.08
70 0.08
71 0.08
72 0.08
73 0.12
74 0.13
75 0.15
76 0.15
77 0.21
78 0.21
79 0.22
80 0.24
81 0.22
82 0.25
83 0.27
84 0.28
85 0.23
86 0.28
87 0.28
88 0.31
89 0.3
90 0.3
91 0.29
92 0.3
93 0.3
94 0.27
95 0.25
96 0.21
97 0.2
98 0.16
99 0.15
100 0.13
101 0.12
102 0.1
103 0.1
104 0.1
105 0.1
106 0.11
107 0.11
108 0.11