Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4UJJ5

Protein Details
Accession G4UJJ5    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
60-87SEKSRVVKKVNNKKDLRKREKQLTQSMQHydrophilic
NLS Segment(s)
PositionSequence
63-78SRVVKKVNNKKDLRKR
Subcellular Location(s) nucl 20, cyto_nucl 12.333, mito_nucl 11.333, cyto 3.5
Family & Domain DBs
Amino Acid Sequences WVMSLDTDYIYLEEPDWSEQSGAWETTYIHVHNKAVPDQKVWQSAAEAKKEKQKGIIVDSEKSRVVKKVNNKKDLRKREKQLTQSMQVTTIVSKAVDTSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.12
4 0.12
5 0.11
6 0.11
7 0.14
8 0.15
9 0.15
10 0.12
11 0.12
12 0.12
13 0.14
14 0.16
15 0.14
16 0.14
17 0.16
18 0.16
19 0.18
20 0.2
21 0.23
22 0.27
23 0.26
24 0.26
25 0.29
26 0.32
27 0.33
28 0.31
29 0.26
30 0.21
31 0.26
32 0.27
33 0.28
34 0.27
35 0.26
36 0.32
37 0.34
38 0.33
39 0.31
40 0.31
41 0.28
42 0.29
43 0.34
44 0.29
45 0.3
46 0.3
47 0.29
48 0.27
49 0.25
50 0.23
51 0.2
52 0.22
53 0.25
54 0.35
55 0.44
56 0.52
57 0.61
58 0.66
59 0.73
60 0.8
61 0.86
62 0.85
63 0.84
64 0.83
65 0.84
66 0.86
67 0.84
68 0.84
69 0.8
70 0.77
71 0.71
72 0.63
73 0.54
74 0.46
75 0.39
76 0.29
77 0.22
78 0.15
79 0.11
80 0.1