Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4UFU4

Protein Details
Accession G4UFU4    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-34TENGKAAVERRKRKKWNEDIKVLQHydrophilic
NLS Segment(s)
PositionSequence
19-25ERRKRKK
Subcellular Location(s) nucl 20, mito 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MTYRIDRVGRTENGKAAVERRKRKKWNEDIKVLQDLYIPNVIGLDGRTDGQLTHLEKMYGYKHKQHTSYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.35
3 0.34
4 0.38
5 0.42
6 0.49
7 0.56
8 0.63
9 0.71
10 0.79
11 0.84
12 0.85
13 0.87
14 0.85
15 0.84
16 0.79
17 0.73
18 0.67
19 0.56
20 0.45
21 0.35
22 0.27
23 0.2
24 0.16
25 0.12
26 0.08
27 0.08
28 0.07
29 0.06
30 0.06
31 0.06
32 0.05
33 0.06
34 0.06
35 0.07
36 0.07
37 0.08
38 0.13
39 0.14
40 0.16
41 0.17
42 0.17
43 0.17
44 0.21
45 0.25
46 0.29
47 0.32
48 0.38
49 0.46
50 0.54