Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4UN43

Protein Details
Accession G4UN43    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
62-86LCEPNRSCKPKGWKKTNKAKKAKKIHydrophilic
NLS Segment(s)
PositionSequence
70-86KPKGWKKTNKAKKAKKI
Subcellular Location(s) mito 15, cyto 8, nucl 3
Family & Domain DBs
Amino Acid Sequences MCRLSPAVRLRTHPIHPPDYVLELGSRVRCVAHEHEKGPVRGHAGAYSGSVGYCCGADVLGLCEPNRSCKPKGWKKTNKAKKAKKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.49
3 0.47
4 0.45
5 0.4
6 0.36
7 0.33
8 0.24
9 0.18
10 0.15
11 0.17
12 0.15
13 0.13
14 0.1
15 0.1
16 0.1
17 0.14
18 0.19
19 0.26
20 0.29
21 0.29
22 0.35
23 0.39
24 0.39
25 0.37
26 0.32
27 0.25
28 0.22
29 0.22
30 0.16
31 0.13
32 0.12
33 0.11
34 0.1
35 0.07
36 0.06
37 0.06
38 0.05
39 0.05
40 0.04
41 0.04
42 0.03
43 0.03
44 0.03
45 0.04
46 0.06
47 0.08
48 0.09
49 0.09
50 0.12
51 0.13
52 0.2
53 0.27
54 0.3
55 0.31
56 0.39
57 0.5
58 0.57
59 0.68
60 0.72
61 0.76
62 0.82
63 0.91
64 0.93
65 0.93
66 0.94