Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4UD89

Protein Details
Accession G4UD89   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
82-101VVNLRPDRRHKLNWKSVRVGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
Amino Acid Sequences MARFMRLKCQGPLTWARRIVPEKADTLRHGCPTPLILDFRVTVRACCTVAGSRSVILRRNKPGWLAVLDWLAKLRLLGLEAVVNLRPDRRHKLNWKSVRVGGGVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.49
3 0.46
4 0.47
5 0.49
6 0.47
7 0.43
8 0.41
9 0.37
10 0.37
11 0.39
12 0.35
13 0.36
14 0.35
15 0.32
16 0.3
17 0.26
18 0.24
19 0.21
20 0.21
21 0.18
22 0.17
23 0.14
24 0.15
25 0.15
26 0.15
27 0.2
28 0.18
29 0.15
30 0.15
31 0.17
32 0.15
33 0.15
34 0.16
35 0.12
36 0.13
37 0.14
38 0.13
39 0.12
40 0.13
41 0.15
42 0.2
43 0.23
44 0.27
45 0.31
46 0.33
47 0.33
48 0.33
49 0.33
50 0.29
51 0.26
52 0.22
53 0.18
54 0.18
55 0.17
56 0.16
57 0.15
58 0.12
59 0.1
60 0.09
61 0.08
62 0.05
63 0.06
64 0.06
65 0.06
66 0.07
67 0.07
68 0.09
69 0.09
70 0.1
71 0.1
72 0.13
73 0.17
74 0.23
75 0.31
76 0.37
77 0.46
78 0.55
79 0.66
80 0.74
81 0.79
82 0.81
83 0.78
84 0.75
85 0.69