Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4UTB2

Protein Details
Accession G4UTB2    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
63-84ALAIRQRSRTPSRPQRPRGLDAHydrophilic
292-313PTGSRPRPPQHKQQQQQQSKVAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MAPPNQEMSAPSRAAVLQEIEDVDGILGGGPFPTFRGRATSDPRPDAQQGQARGPERQLAAAALAIRQRSRTPSRPQRPRGLDALVEEPFPPMPSLPFRPPNPPFAQPSFGSGRPSRSRTGPADFPQKAPPRGFVLPPARQPPRDVRSPSGSQHMGQPVSSHPGPSLPPPPPIPPKSAQRQVQDNRRPSASGSRPTTSLNQAVLSRSSPPAPPPQPQVSRSFEGHQASSSSRPPVQTPPFEDDVFKGHLNPNNPYGYKQPPSFHHNWDTPARDQCMGIKPHGRPSHPFQGPPTGSRPRPPQHKQQQQQQSKVALPSQSSSSGASARARQAGHSTEPSYFDLSSLPPPRLQAQPGNGHSAQTVTSPVPNPVVTTTTEFGYHPMMSPYEAEAASGMVRARVESPKKNSYTPGGDHWTSARDMLSPVEAAVACADTRRRTIFMDMGVQYADDHEDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.2
4 0.14
5 0.15
6 0.16
7 0.15
8 0.14
9 0.13
10 0.1
11 0.08
12 0.07
13 0.06
14 0.05
15 0.04
16 0.05
17 0.05
18 0.05
19 0.07
20 0.1
21 0.11
22 0.12
23 0.18
24 0.22
25 0.31
26 0.39
27 0.47
28 0.52
29 0.56
30 0.57
31 0.56
32 0.55
33 0.51
34 0.51
35 0.48
36 0.43
37 0.44
38 0.48
39 0.45
40 0.45
41 0.42
42 0.4
43 0.34
44 0.31
45 0.26
46 0.2
47 0.18
48 0.17
49 0.16
50 0.13
51 0.14
52 0.15
53 0.16
54 0.17
55 0.19
56 0.25
57 0.33
58 0.4
59 0.48
60 0.58
61 0.68
62 0.77
63 0.82
64 0.85
65 0.84
66 0.8
67 0.74
68 0.66
69 0.57
70 0.49
71 0.46
72 0.36
73 0.29
74 0.25
75 0.2
76 0.17
77 0.16
78 0.13
79 0.09
80 0.11
81 0.16
82 0.22
83 0.28
84 0.36
85 0.37
86 0.46
87 0.49
88 0.54
89 0.53
90 0.52
91 0.51
92 0.47
93 0.49
94 0.4
95 0.42
96 0.39
97 0.36
98 0.37
99 0.33
100 0.37
101 0.39
102 0.42
103 0.4
104 0.39
105 0.44
106 0.43
107 0.47
108 0.46
109 0.45
110 0.52
111 0.5
112 0.49
113 0.51
114 0.54
115 0.53
116 0.47
117 0.44
118 0.4
119 0.41
120 0.39
121 0.38
122 0.4
123 0.39
124 0.43
125 0.49
126 0.47
127 0.45
128 0.49
129 0.5
130 0.46
131 0.49
132 0.48
133 0.45
134 0.48
135 0.5
136 0.48
137 0.45
138 0.42
139 0.34
140 0.35
141 0.35
142 0.29
143 0.25
144 0.24
145 0.19
146 0.23
147 0.23
148 0.18
149 0.13
150 0.15
151 0.16
152 0.18
153 0.23
154 0.19
155 0.22
156 0.24
157 0.29
158 0.36
159 0.37
160 0.39
161 0.38
162 0.43
163 0.48
164 0.54
165 0.55
166 0.51
167 0.59
168 0.61
169 0.67
170 0.68
171 0.65
172 0.6
173 0.54
174 0.5
175 0.42
176 0.45
177 0.4
178 0.39
179 0.38
180 0.36
181 0.36
182 0.38
183 0.39
184 0.32
185 0.29
186 0.22
187 0.19
188 0.18
189 0.18
190 0.17
191 0.15
192 0.14
193 0.12
194 0.13
195 0.12
196 0.14
197 0.21
198 0.23
199 0.26
200 0.29
201 0.36
202 0.39
203 0.41
204 0.44
205 0.41
206 0.41
207 0.39
208 0.36
209 0.33
210 0.3
211 0.28
212 0.22
213 0.19
214 0.17
215 0.18
216 0.17
217 0.15
218 0.15
219 0.15
220 0.17
221 0.23
222 0.27
223 0.27
224 0.29
225 0.32
226 0.33
227 0.33
228 0.31
229 0.24
230 0.22
231 0.22
232 0.18
233 0.15
234 0.16
235 0.19
236 0.21
237 0.22
238 0.22
239 0.24
240 0.24
241 0.24
242 0.25
243 0.28
244 0.3
245 0.31
246 0.31
247 0.31
248 0.39
249 0.41
250 0.42
251 0.42
252 0.39
253 0.4
254 0.42
255 0.42
256 0.37
257 0.38
258 0.35
259 0.3
260 0.28
261 0.28
262 0.3
263 0.28
264 0.28
265 0.3
266 0.29
267 0.37
268 0.42
269 0.39
270 0.37
271 0.43
272 0.5
273 0.46
274 0.46
275 0.39
276 0.44
277 0.44
278 0.42
279 0.41
280 0.38
281 0.37
282 0.42
283 0.48
284 0.46
285 0.55
286 0.58
287 0.62
288 0.66
289 0.75
290 0.77
291 0.78
292 0.82
293 0.8
294 0.81
295 0.75
296 0.67
297 0.59
298 0.54
299 0.47
300 0.38
301 0.3
302 0.26
303 0.23
304 0.2
305 0.18
306 0.17
307 0.16
308 0.15
309 0.16
310 0.17
311 0.18
312 0.19
313 0.23
314 0.22
315 0.22
316 0.24
317 0.25
318 0.27
319 0.27
320 0.27
321 0.24
322 0.27
323 0.27
324 0.26
325 0.22
326 0.18
327 0.16
328 0.16
329 0.22
330 0.23
331 0.22
332 0.21
333 0.23
334 0.26
335 0.29
336 0.31
337 0.29
338 0.32
339 0.4
340 0.41
341 0.46
342 0.43
343 0.4
344 0.36
345 0.3
346 0.24
347 0.16
348 0.17
349 0.11
350 0.14
351 0.15
352 0.16
353 0.18
354 0.17
355 0.18
356 0.17
357 0.18
358 0.16
359 0.19
360 0.19
361 0.17
362 0.19
363 0.18
364 0.18
365 0.19
366 0.17
367 0.14
368 0.15
369 0.15
370 0.14
371 0.15
372 0.15
373 0.15
374 0.15
375 0.14
376 0.12
377 0.12
378 0.11
379 0.12
380 0.1
381 0.08
382 0.09
383 0.1
384 0.13
385 0.21
386 0.29
387 0.36
388 0.44
389 0.51
390 0.55
391 0.57
392 0.58
393 0.56
394 0.56
395 0.51
396 0.51
397 0.49
398 0.45
399 0.44
400 0.41
401 0.37
402 0.31
403 0.28
404 0.21
405 0.15
406 0.16
407 0.16
408 0.16
409 0.13
410 0.12
411 0.14
412 0.14
413 0.13
414 0.13
415 0.12
416 0.1
417 0.13
418 0.17
419 0.17
420 0.22
421 0.25
422 0.26
423 0.28
424 0.34
425 0.35
426 0.34
427 0.4
428 0.36
429 0.34
430 0.31
431 0.28
432 0.23
433 0.2
434 0.18
435 0.1