Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4USX1

Protein Details
Accession G4USX1   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
48-67NKCSNTPPIKIKNKDKWINVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 16.5, cyto_nucl 11, nucl 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001853  DSBA-like_thioredoxin_dom  
IPR044088  GSTK  
IPR014440  HCCAis_GSTk  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0043231  C:intracellular membrane-bounded organelle  
GO:0004602  F:glutathione peroxidase activity  
GO:0004364  F:glutathione transferase activity  
GO:0016853  F:isomerase activity  
GO:0006749  P:glutathione metabolic process  
Pfam View protein in Pfam  
PF01323  DSBA  
CDD cd03021  DsbA_GSTK  
Amino Acid Sequences MVPKPKITLYLDTVSPFAYEAYHILRNDPIFKNVDIKYVPIFLGGLMNKCSNTPPIKIKNKDKWINVERLRWAHAFSVPIVTDMPPNFPPNTLPVQRVLAGIEASSQSQSAVIAALDALYKSYWALGQPIYEPAQLRSVLASSLGGEEAADKVLGAAQTAEVKQRLVENTDKAFAEGAFGLPWFTCTNTKGETEGFWGVDHLGQVVQFLGLDKGVSGNGGWKSVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.24
3 0.19
4 0.13
5 0.1
6 0.09
7 0.1
8 0.14
9 0.19
10 0.19
11 0.2
12 0.24
13 0.25
14 0.31
15 0.31
16 0.31
17 0.28
18 0.29
19 0.35
20 0.31
21 0.35
22 0.28
23 0.28
24 0.26
25 0.24
26 0.23
27 0.17
28 0.16
29 0.11
30 0.15
31 0.15
32 0.15
33 0.16
34 0.17
35 0.17
36 0.17
37 0.18
38 0.19
39 0.21
40 0.24
41 0.31
42 0.4
43 0.5
44 0.58
45 0.67
46 0.71
47 0.78
48 0.8
49 0.76
50 0.76
51 0.71
52 0.73
53 0.68
54 0.63
55 0.58
56 0.52
57 0.52
58 0.42
59 0.38
60 0.29
61 0.26
62 0.22
63 0.17
64 0.18
65 0.15
66 0.14
67 0.14
68 0.12
69 0.13
70 0.12
71 0.15
72 0.14
73 0.16
74 0.15
75 0.15
76 0.16
77 0.16
78 0.22
79 0.2
80 0.2
81 0.19
82 0.21
83 0.21
84 0.21
85 0.17
86 0.12
87 0.1
88 0.09
89 0.08
90 0.06
91 0.06
92 0.06
93 0.05
94 0.04
95 0.05
96 0.05
97 0.04
98 0.04
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.04
110 0.04
111 0.04
112 0.06
113 0.06
114 0.07
115 0.07
116 0.1
117 0.11
118 0.12
119 0.12
120 0.12
121 0.14
122 0.14
123 0.13
124 0.11
125 0.1
126 0.09
127 0.09
128 0.08
129 0.05
130 0.05
131 0.05
132 0.05
133 0.04
134 0.05
135 0.05
136 0.05
137 0.04
138 0.04
139 0.04
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.08
146 0.08
147 0.11
148 0.1
149 0.11
150 0.11
151 0.15
152 0.15
153 0.17
154 0.21
155 0.23
156 0.25
157 0.27
158 0.27
159 0.24
160 0.23
161 0.19
162 0.16
163 0.12
164 0.1
165 0.08
166 0.08
167 0.08
168 0.07
169 0.09
170 0.08
171 0.1
172 0.13
173 0.14
174 0.17
175 0.19
176 0.21
177 0.21
178 0.21
179 0.2
180 0.21
181 0.22
182 0.19
183 0.17
184 0.16
185 0.15
186 0.15
187 0.14
188 0.1
189 0.08
190 0.07
191 0.08
192 0.07
193 0.07
194 0.06
195 0.07
196 0.07
197 0.07
198 0.07
199 0.06
200 0.07
201 0.07
202 0.07
203 0.07
204 0.12
205 0.13