Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4UH81

Protein Details
Accession G4UH81    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MGRELQKRKKRSSRAKVQTHTIKKKHLNPQGSHydrophilic
NLS Segment(s)
PositionSequence
7-25KRKKRSSRAKVQTHTIKKK
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR019002  Ribosome_biogenesis_Nop16  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF09420  Nop16  
Amino Acid Sequences MGRELQKRKKRSSRAKVQTHTIKKKHLNPQGSGIVAKAWNKKETLSQNYSRFGLVAKLGTAAGGMAKKSAAANYAGITKDDPLAVKSADRGLLEVREVKVERDASGKIVKVLRSNNPLNDPLNEIESDSESEEPKPKNPTHDIEWHGISDDRQEMIAQSSRPEVVRMLEEEASRPAEKTVRYQSERELEWLQRLVAKHGDDVAAMVRDIKLNPMQQTKGDITKRLKKAGLLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.93
3 0.88
4 0.88
5 0.88
6 0.87
7 0.87
8 0.82
9 0.81
10 0.79
11 0.82
12 0.82
13 0.81
14 0.77
15 0.7
16 0.71
17 0.66
18 0.59
19 0.49
20 0.39
21 0.33
22 0.28
23 0.3
24 0.3
25 0.29
26 0.3
27 0.31
28 0.32
29 0.37
30 0.43
31 0.46
32 0.47
33 0.51
34 0.53
35 0.56
36 0.55
37 0.47
38 0.38
39 0.3
40 0.24
41 0.18
42 0.14
43 0.11
44 0.11
45 0.1
46 0.1
47 0.09
48 0.07
49 0.07
50 0.07
51 0.07
52 0.06
53 0.06
54 0.07
55 0.08
56 0.08
57 0.08
58 0.08
59 0.09
60 0.1
61 0.13
62 0.13
63 0.13
64 0.13
65 0.12
66 0.11
67 0.11
68 0.11
69 0.08
70 0.09
71 0.09
72 0.09
73 0.09
74 0.1
75 0.11
76 0.11
77 0.11
78 0.1
79 0.11
80 0.12
81 0.13
82 0.12
83 0.14
84 0.14
85 0.14
86 0.16
87 0.16
88 0.16
89 0.15
90 0.15
91 0.14
92 0.16
93 0.16
94 0.15
95 0.17
96 0.17
97 0.19
98 0.22
99 0.24
100 0.28
101 0.3
102 0.29
103 0.3
104 0.31
105 0.28
106 0.26
107 0.23
108 0.18
109 0.17
110 0.15
111 0.12
112 0.1
113 0.1
114 0.1
115 0.08
116 0.09
117 0.08
118 0.09
119 0.15
120 0.15
121 0.18
122 0.23
123 0.23
124 0.28
125 0.33
126 0.35
127 0.35
128 0.41
129 0.42
130 0.39
131 0.39
132 0.33
133 0.29
134 0.25
135 0.2
136 0.15
137 0.13
138 0.1
139 0.09
140 0.09
141 0.09
142 0.11
143 0.14
144 0.12
145 0.12
146 0.13
147 0.14
148 0.15
149 0.15
150 0.13
151 0.11
152 0.13
153 0.13
154 0.15
155 0.16
156 0.16
157 0.17
158 0.18
159 0.19
160 0.18
161 0.17
162 0.15
163 0.17
164 0.18
165 0.23
166 0.31
167 0.37
168 0.4
169 0.42
170 0.46
171 0.48
172 0.48
173 0.46
174 0.41
175 0.33
176 0.34
177 0.33
178 0.28
179 0.25
180 0.25
181 0.24
182 0.24
183 0.24
184 0.21
185 0.21
186 0.21
187 0.17
188 0.17
189 0.16
190 0.13
191 0.11
192 0.11
193 0.1
194 0.12
195 0.12
196 0.16
197 0.18
198 0.22
199 0.28
200 0.34
201 0.35
202 0.35
203 0.41
204 0.41
205 0.45
206 0.45
207 0.47
208 0.5
209 0.58
210 0.62
211 0.63
212 0.61