Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4UCF4

Protein Details
Accession G4UCF4   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
46-65AEEFRRIKRRQNKPAAPGSSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01717  Sm_B  
Amino Acid Sequences MASTNKQGKMAGYINYRMRVTLNDGRQMTGQMLAFDKHMNLVLADAEEFRRIKRRQNKPAAPGSSAPAVQTVEQEEKRTLGLTIIRGAHIVSLSVESPPPADPSARLGKSTGGGLASTLQAGPGVARPAGRGAAAPISLAGPAAGVGGAAPPPPFPGFPGAAPPGFPGRGGPPPPGFPVFPPAAGFPGAPGFPPSFPPPGAGGPAGFNPPPRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.44
3 0.43
4 0.37
5 0.35
6 0.31
7 0.34
8 0.35
9 0.35
10 0.39
11 0.39
12 0.4
13 0.39
14 0.38
15 0.31
16 0.26
17 0.21
18 0.15
19 0.16
20 0.15
21 0.15
22 0.15
23 0.14
24 0.11
25 0.12
26 0.11
27 0.09
28 0.09
29 0.08
30 0.08
31 0.08
32 0.08
33 0.08
34 0.11
35 0.12
36 0.13
37 0.22
38 0.23
39 0.33
40 0.43
41 0.53
42 0.6
43 0.71
44 0.77
45 0.76
46 0.83
47 0.77
48 0.69
49 0.6
50 0.51
51 0.42
52 0.34
53 0.27
54 0.19
55 0.16
56 0.13
57 0.13
58 0.13
59 0.16
60 0.17
61 0.19
62 0.18
63 0.18
64 0.17
65 0.17
66 0.14
67 0.1
68 0.12
69 0.11
70 0.14
71 0.14
72 0.13
73 0.13
74 0.13
75 0.11
76 0.09
77 0.08
78 0.05
79 0.05
80 0.05
81 0.06
82 0.06
83 0.05
84 0.06
85 0.06
86 0.08
87 0.07
88 0.07
89 0.08
90 0.12
91 0.19
92 0.19
93 0.19
94 0.18
95 0.18
96 0.18
97 0.18
98 0.14
99 0.07
100 0.06
101 0.06
102 0.07
103 0.06
104 0.05
105 0.05
106 0.04
107 0.04
108 0.04
109 0.04
110 0.05
111 0.05
112 0.06
113 0.06
114 0.07
115 0.08
116 0.08
117 0.08
118 0.07
119 0.07
120 0.08
121 0.08
122 0.07
123 0.07
124 0.06
125 0.06
126 0.06
127 0.05
128 0.03
129 0.03
130 0.03
131 0.03
132 0.02
133 0.02
134 0.03
135 0.03
136 0.04
137 0.04
138 0.04
139 0.07
140 0.08
141 0.08
142 0.09
143 0.13
144 0.14
145 0.14
146 0.19
147 0.2
148 0.19
149 0.19
150 0.19
151 0.19
152 0.18
153 0.17
154 0.14
155 0.15
156 0.22
157 0.24
158 0.28
159 0.27
160 0.29
161 0.33
162 0.34
163 0.31
164 0.26
165 0.3
166 0.26
167 0.24
168 0.23
169 0.2
170 0.19
171 0.19
172 0.18
173 0.12
174 0.14
175 0.13
176 0.12
177 0.14
178 0.14
179 0.14
180 0.18
181 0.21
182 0.22
183 0.22
184 0.24
185 0.25
186 0.25
187 0.27
188 0.24
189 0.21
190 0.19
191 0.21
192 0.23
193 0.21