Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4URN4

Protein Details
Accession G4URN4    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
57-84LAPILKRPWKRTRTSRRTTGRQGRPGPAHydrophilic
NLS Segment(s)
PositionSequence
61-87LKRPWKRTRTSRRTTGRQGRPGPAKSR
Subcellular Location(s) nucl 12.5, mito 9, cyto_nucl 9, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MVLEPVVRYRYLDGEVRSCSREFSSKRKCRIDPPMSDLPSRRAGPDSLGNMNLEPRLAPILKRPWKRTRTSRRTTGRQGRPGPAKSRHVTHPGTLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.3
3 0.32
4 0.32
5 0.3
6 0.28
7 0.26
8 0.31
9 0.31
10 0.38
11 0.47
12 0.53
13 0.61
14 0.68
15 0.68
16 0.68
17 0.75
18 0.72
19 0.66
20 0.65
21 0.65
22 0.59
23 0.58
24 0.51
25 0.44
26 0.41
27 0.36
28 0.3
29 0.22
30 0.2
31 0.21
32 0.23
33 0.22
34 0.18
35 0.18
36 0.17
37 0.16
38 0.16
39 0.13
40 0.09
41 0.06
42 0.06
43 0.07
44 0.08
45 0.08
46 0.14
47 0.24
48 0.33
49 0.4
50 0.47
51 0.55
52 0.62
53 0.7
54 0.75
55 0.76
56 0.78
57 0.8
58 0.83
59 0.82
60 0.84
61 0.86
62 0.86
63 0.84
64 0.83
65 0.8
66 0.79
67 0.78
68 0.76
69 0.73
70 0.71
71 0.69
72 0.64
73 0.64
74 0.62
75 0.61
76 0.58