Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UUW7

Protein Details
Accession Q0UUW7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
74-112LGLSEEKKKKITRKWCRKCEAPKPPRAHHCKACKRCIPKBasic
NLS Segment(s)
PositionSequence
81-86KKKITR
Subcellular Location(s) plas 16, pero 3, extr 2, golg 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001594  Palmitoyltrfase_DHHC  
IPR033682  PFA4  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0005789  C:endoplasmic reticulum membrane  
GO:0005794  C:Golgi apparatus  
GO:0019706  F:protein-cysteine S-palmitoyltransferase activity  
GO:0018230  P:peptidyl-L-cysteine S-palmitoylation  
GO:0006612  P:protein targeting to membrane  
KEGG pno:SNOG_04447  -  
Pfam View protein in Pfam  
PF01529  DHHC  
PROSITE View protein in PROSITE  
PS50216  DHHC  
Amino Acid Sequences MELSQLAVPSVYVLIFFLGYPSQWLLTQLEPRPLTKNELIFANVILVLIFITYTKSVFVDPGRIPKDWAEKQELGLSEEKKKKITRKWCRKCEAPKPPRAHHCKACKRCIPKMDHHCPWTSSCVSHTTFPHFLRFLVSTTVGLSFLQLLLFTRLSHLWNSRHLPASLGPSPFLLFHLFATTLANSLTLFAVGILALRNIWVLAINVTTIEGWEIERHRTLLRRARHFGGYLETPDGQAIRIKKQEFPYDIGILRNICQGMGSANPLMWFNPLAPSPSVQSALQFEVNGFEDEGTVWPPPDPDRSYKKVERGAEGEAFVFGGEGEGEDTIKAFRARQAQDVVRRRKPFVERLEERVDRDGYEDEYEYGEEASDGEEEEKESYGEGEGEEGWRNSEGERLQDFGVDEDVEFYDEQEDEIPLAELMARIQAASSGASYP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.07
4 0.07
5 0.07
6 0.08
7 0.1
8 0.11
9 0.11
10 0.11
11 0.14
12 0.15
13 0.19
14 0.27
15 0.29
16 0.36
17 0.37
18 0.39
19 0.42
20 0.42
21 0.45
22 0.42
23 0.42
24 0.35
25 0.36
26 0.36
27 0.31
28 0.28
29 0.22
30 0.17
31 0.13
32 0.11
33 0.08
34 0.06
35 0.05
36 0.05
37 0.04
38 0.05
39 0.06
40 0.06
41 0.07
42 0.08
43 0.09
44 0.12
45 0.14
46 0.19
47 0.21
48 0.31
49 0.33
50 0.33
51 0.34
52 0.37
53 0.45
54 0.44
55 0.46
56 0.45
57 0.43
58 0.44
59 0.47
60 0.43
61 0.36
62 0.36
63 0.34
64 0.35
65 0.41
66 0.42
67 0.43
68 0.49
69 0.55
70 0.59
71 0.67
72 0.69
73 0.74
74 0.82
75 0.87
76 0.88
77 0.89
78 0.89
79 0.89
80 0.89
81 0.88
82 0.86
83 0.84
84 0.85
85 0.85
86 0.84
87 0.81
88 0.79
89 0.8
90 0.82
91 0.82
92 0.84
93 0.81
94 0.8
95 0.79
96 0.79
97 0.75
98 0.75
99 0.77
100 0.76
101 0.75
102 0.71
103 0.66
104 0.59
105 0.54
106 0.49
107 0.4
108 0.31
109 0.26
110 0.28
111 0.27
112 0.28
113 0.28
114 0.29
115 0.33
116 0.33
117 0.36
118 0.31
119 0.29
120 0.28
121 0.27
122 0.22
123 0.18
124 0.18
125 0.14
126 0.14
127 0.14
128 0.11
129 0.1
130 0.09
131 0.07
132 0.06
133 0.06
134 0.05
135 0.05
136 0.08
137 0.08
138 0.08
139 0.09
140 0.1
141 0.12
142 0.15
143 0.19
144 0.19
145 0.25
146 0.29
147 0.3
148 0.32
149 0.3
150 0.29
151 0.26
152 0.3
153 0.28
154 0.25
155 0.22
156 0.2
157 0.2
158 0.18
159 0.17
160 0.12
161 0.09
162 0.08
163 0.09
164 0.09
165 0.09
166 0.1
167 0.09
168 0.08
169 0.07
170 0.07
171 0.05
172 0.06
173 0.06
174 0.04
175 0.04
176 0.04
177 0.04
178 0.03
179 0.04
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.03
187 0.03
188 0.03
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.04
195 0.04
196 0.04
197 0.03
198 0.04
199 0.06
200 0.07
201 0.09
202 0.09
203 0.11
204 0.12
205 0.15
206 0.21
207 0.27
208 0.33
209 0.38
210 0.41
211 0.43
212 0.43
213 0.41
214 0.35
215 0.31
216 0.25
217 0.2
218 0.18
219 0.15
220 0.13
221 0.13
222 0.12
223 0.09
224 0.1
225 0.11
226 0.14
227 0.19
228 0.2
229 0.24
230 0.28
231 0.34
232 0.34
233 0.36
234 0.35
235 0.32
236 0.32
237 0.28
238 0.25
239 0.2
240 0.18
241 0.16
242 0.12
243 0.09
244 0.08
245 0.08
246 0.07
247 0.08
248 0.09
249 0.07
250 0.07
251 0.08
252 0.08
253 0.08
254 0.08
255 0.08
256 0.06
257 0.09
258 0.09
259 0.1
260 0.11
261 0.11
262 0.12
263 0.13
264 0.15
265 0.13
266 0.13
267 0.13
268 0.15
269 0.15
270 0.13
271 0.12
272 0.12
273 0.13
274 0.12
275 0.1
276 0.08
277 0.08
278 0.08
279 0.09
280 0.08
281 0.07
282 0.07
283 0.07
284 0.08
285 0.1
286 0.15
287 0.18
288 0.24
289 0.31
290 0.36
291 0.44
292 0.48
293 0.53
294 0.55
295 0.55
296 0.52
297 0.47
298 0.46
299 0.4
300 0.35
301 0.28
302 0.21
303 0.18
304 0.13
305 0.1
306 0.06
307 0.04
308 0.03
309 0.03
310 0.04
311 0.04
312 0.04
313 0.04
314 0.05
315 0.05
316 0.07
317 0.08
318 0.09
319 0.13
320 0.22
321 0.24
322 0.29
323 0.36
324 0.4
325 0.49
326 0.58
327 0.63
328 0.63
329 0.65
330 0.63
331 0.64
332 0.64
333 0.64
334 0.63
335 0.65
336 0.6
337 0.63
338 0.7
339 0.64
340 0.6
341 0.55
342 0.47
343 0.36
344 0.34
345 0.29
346 0.22
347 0.22
348 0.2
349 0.16
350 0.16
351 0.16
352 0.14
353 0.12
354 0.1
355 0.07
356 0.07
357 0.07
358 0.06
359 0.06
360 0.07
361 0.07
362 0.08
363 0.09
364 0.1
365 0.09
366 0.09
367 0.09
368 0.09
369 0.09
370 0.08
371 0.08
372 0.08
373 0.1
374 0.12
375 0.12
376 0.13
377 0.13
378 0.14
379 0.13
380 0.18
381 0.18
382 0.21
383 0.23
384 0.23
385 0.23
386 0.24
387 0.24
388 0.2
389 0.21
390 0.15
391 0.13
392 0.13
393 0.13
394 0.12
395 0.12
396 0.11
397 0.11
398 0.1
399 0.11
400 0.1
401 0.1
402 0.09
403 0.1
404 0.1
405 0.08
406 0.08
407 0.08
408 0.07
409 0.07
410 0.09
411 0.08
412 0.07
413 0.08
414 0.08
415 0.09
416 0.09