Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4US97

Protein Details
Accession G4US97    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
43-64PGIFFRKTTRRGRQHPSREISIHydrophilic
NLS Segment(s)
PositionSequence
16-54RKRGSPRRWNTGTRRGTVWGERKREAIPGIFFRKTTRRG
Subcellular Location(s) mito 17, nucl 8.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences LLYGVELLGQLLFRLRKRGSPRRWNTGTRRGTVWGERKREAIPGIFFRKTTRRGRQHPSREISIFIAKDITRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.29
4 0.39
5 0.5
6 0.56
7 0.64
8 0.7
9 0.73
10 0.78
11 0.79
12 0.77
13 0.77
14 0.71
15 0.62
16 0.56
17 0.49
18 0.46
19 0.44
20 0.46
21 0.42
22 0.42
23 0.41
24 0.41
25 0.39
26 0.39
27 0.33
28 0.27
29 0.23
30 0.25
31 0.29
32 0.28
33 0.28
34 0.29
35 0.34
36 0.38
37 0.45
38 0.49
39 0.54
40 0.61
41 0.71
42 0.79
43 0.82
44 0.84
45 0.81
46 0.77
47 0.68
48 0.63
49 0.57
50 0.53
51 0.42
52 0.33
53 0.31