Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4UV37

Protein Details
Accession G4UV37    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
46-68DLATQIKVRWRRRRDTPKCCVVNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito_nucl 10.833, cyto_nucl 10.333, mito 4.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MYEMKSRGSHSKNLEFSNELPRSGTQLGEDEQWCKISEALQLQFCDLATQIKVRWRRRRDTPKCCVVNVNNDEGRLYTVIKKAMIGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.47
3 0.45
4 0.48
5 0.41
6 0.32
7 0.29
8 0.27
9 0.28
10 0.26
11 0.24
12 0.14
13 0.15
14 0.16
15 0.18
16 0.18
17 0.15
18 0.14
19 0.15
20 0.15
21 0.13
22 0.12
23 0.1
24 0.12
25 0.15
26 0.17
27 0.18
28 0.18
29 0.17
30 0.17
31 0.16
32 0.13
33 0.09
34 0.08
35 0.06
36 0.07
37 0.08
38 0.14
39 0.23
40 0.33
41 0.43
42 0.49
43 0.56
44 0.66
45 0.76
46 0.81
47 0.82
48 0.82
49 0.82
50 0.78
51 0.73
52 0.69
53 0.62
54 0.61
55 0.54
56 0.53
57 0.44
58 0.41
59 0.39
60 0.32
61 0.3
62 0.21
63 0.2
64 0.17
65 0.2
66 0.22
67 0.22