Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4UZR8

Protein Details
Accession G4UZR8    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
63-94LPSRKTKKNDEESKPEKKRKKSNVPRAAMQRAHydrophilic
NLS Segment(s)
PositionSequence
65-87SRKTKKNDEESKPEKKRKKSNVP
Subcellular Location(s) mito 21, nucl 4.5, cyto_nucl 3.5
Family & Domain DBs
Amino Acid Sequences MALTKKLLSARVHRTRFNIVHASQVNRKSVIDPISSRHQETPPRSKVRPIRLLALHHGAILALPSRKTKKNDEESKPEKKRKKSNVPRAAMQRASPDAGHVGHVSGYHGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.62
3 0.59
4 0.57
5 0.53
6 0.43
7 0.47
8 0.47
9 0.47
10 0.45
11 0.47
12 0.43
13 0.37
14 0.37
15 0.29
16 0.3
17 0.29
18 0.26
19 0.23
20 0.25
21 0.33
22 0.34
23 0.35
24 0.33
25 0.34
26 0.38
27 0.44
28 0.49
29 0.49
30 0.54
31 0.52
32 0.57
33 0.6
34 0.62
35 0.63
36 0.55
37 0.52
38 0.49
39 0.5
40 0.45
41 0.41
42 0.31
43 0.23
44 0.21
45 0.15
46 0.11
47 0.09
48 0.08
49 0.06
50 0.07
51 0.11
52 0.15
53 0.21
54 0.26
55 0.34
56 0.42
57 0.51
58 0.61
59 0.64
60 0.7
61 0.72
62 0.79
63 0.81
64 0.81
65 0.79
66 0.78
67 0.82
68 0.82
69 0.86
70 0.87
71 0.88
72 0.89
73 0.86
74 0.84
75 0.82
76 0.79
77 0.7
78 0.61
79 0.54
80 0.47
81 0.43
82 0.35
83 0.28
84 0.23
85 0.21
86 0.22
87 0.17
88 0.14
89 0.13
90 0.13