Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4UHQ3

Protein Details
Accession G4UHQ3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKRKKSSRKPQGPRRNDPLPTBasic
NLS Segment(s)
PositionSequence
3-16KRKKSSRKPQGPRR
Subcellular Location(s) mito 12, cyto 12, cyto_mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRKPQGPRRNDPLPTVFTCLFCNHERSVIVKLDKKAGVGYLDCKICGQKFQCPVNYLDAAVDVYSAWVDAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.89
3 0.86
4 0.77
5 0.71
6 0.65
7 0.59
8 0.51
9 0.47
10 0.4
11 0.32
12 0.31
13 0.27
14 0.26
15 0.23
16 0.24
17 0.19
18 0.2
19 0.19
20 0.19
21 0.22
22 0.22
23 0.23
24 0.24
25 0.24
26 0.27
27 0.26
28 0.25
29 0.21
30 0.18
31 0.16
32 0.13
33 0.14
34 0.15
35 0.15
36 0.14
37 0.15
38 0.16
39 0.15
40 0.2
41 0.21
42 0.23
43 0.31
44 0.36
45 0.4
46 0.41
47 0.42
48 0.42
49 0.4
50 0.33
51 0.26
52 0.21
53 0.17
54 0.14
55 0.12
56 0.07
57 0.06
58 0.06