Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4U647

Protein Details
Accession G4U647    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGSFTSRRRRGRFLVRTRDKSLQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2, plas 2
Family & Domain DBs
Amino Acid Sequences MGSFTSRRRRGRFLVRTRDKSLQVVQCLEITGNFIARRLTKSALAMVVQTLPYRFLLNNLPILEAAAEKWTRIGTVSLVWFH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.83
4 0.82
5 0.79
6 0.7
7 0.64
8 0.61
9 0.55
10 0.48
11 0.42
12 0.37
13 0.31
14 0.29
15 0.24
16 0.16
17 0.13
18 0.1
19 0.1
20 0.09
21 0.09
22 0.1
23 0.11
24 0.13
25 0.14
26 0.15
27 0.14
28 0.14
29 0.15
30 0.14
31 0.13
32 0.11
33 0.09
34 0.09
35 0.08
36 0.08
37 0.07
38 0.07
39 0.08
40 0.09
41 0.08
42 0.1
43 0.14
44 0.16
45 0.2
46 0.19
47 0.2
48 0.18
49 0.18
50 0.17
51 0.12
52 0.11
53 0.11
54 0.11
55 0.1
56 0.11
57 0.11
58 0.11
59 0.12
60 0.13
61 0.1
62 0.14