Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4UQ71

Protein Details
Accession G4UQ71   
Localization Confidence Low
Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
34-59RVEYDIGRRRRRRQQQQQQQGSKKLQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 6.5, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences RRSTNSGLFKIDAIKASWFPGLSSGIWMTGKEGRVEYDIGRRRRRRQQQQQQQGSKKLQKPLVSVRLGSLRILQGLENGRPGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.2
4 0.2
5 0.17
6 0.15
7 0.15
8 0.15
9 0.13
10 0.14
11 0.12
12 0.12
13 0.12
14 0.12
15 0.12
16 0.14
17 0.14
18 0.13
19 0.13
20 0.13
21 0.14
22 0.15
23 0.14
24 0.2
25 0.26
26 0.32
27 0.41
28 0.46
29 0.52
30 0.61
31 0.71
32 0.74
33 0.78
34 0.82
35 0.84
36 0.89
37 0.92
38 0.91
39 0.87
40 0.82
41 0.79
42 0.76
43 0.7
44 0.66
45 0.61
46 0.55
47 0.54
48 0.57
49 0.57
50 0.51
51 0.46
52 0.42
53 0.42
54 0.39
55 0.34
56 0.28
57 0.21
58 0.2
59 0.2
60 0.17
61 0.17
62 0.21
63 0.22