Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UIJ8

Protein Details
Accession Q0UIJ8   
Localization Confidence Low
Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
227-247VDSPGCIPRRHRRSQACSDSEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10.5, cyto_mito 10.333, cyto 9, cyto_nucl 7.833, nucl 5.5
Family & Domain DBs
KEGG pno:SNOG_08416  -  
Amino Acid Sequences MVVVGADPVTQRTWYLSKALLIRHCTHLAEICTNPFLTSVTLEDVDIRAFTNFVDYMRSSIYTLNEQIPGYRRVHEGIKACLIGQKLGCMAYSNAAIISLHMGFEPLAQLKTSNKRLSTIRAEDIDFVCRNTNKDENNNDLCKGLRQLFHDAVASHWSNWEVNKLTGHHDEYMGDWTELCVNYDDFRVTLLASCRTSDAQRHALFKPVNQYLSVEKRKVDEEATVKVDSPGCIPRRHRRSQACSDSEACSFWERAEAGIVNTGATQNGDEDALGREETGEVRARDGNGWTMVNGATKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.22
4 0.26
5 0.29
6 0.35
7 0.37
8 0.4
9 0.42
10 0.44
11 0.44
12 0.4
13 0.38
14 0.37
15 0.34
16 0.33
17 0.31
18 0.28
19 0.27
20 0.27
21 0.25
22 0.2
23 0.17
24 0.13
25 0.13
26 0.12
27 0.13
28 0.13
29 0.13
30 0.14
31 0.13
32 0.12
33 0.11
34 0.1
35 0.08
36 0.07
37 0.07
38 0.09
39 0.09
40 0.09
41 0.13
42 0.13
43 0.14
44 0.15
45 0.17
46 0.14
47 0.16
48 0.18
49 0.18
50 0.2
51 0.2
52 0.21
53 0.2
54 0.22
55 0.24
56 0.26
57 0.24
58 0.24
59 0.24
60 0.24
61 0.27
62 0.29
63 0.29
64 0.28
65 0.29
66 0.27
67 0.26
68 0.26
69 0.24
70 0.21
71 0.17
72 0.15
73 0.12
74 0.12
75 0.12
76 0.11
77 0.11
78 0.1
79 0.1
80 0.09
81 0.08
82 0.08
83 0.08
84 0.06
85 0.08
86 0.06
87 0.06
88 0.05
89 0.06
90 0.06
91 0.06
92 0.07
93 0.07
94 0.07
95 0.07
96 0.08
97 0.13
98 0.2
99 0.28
100 0.3
101 0.3
102 0.32
103 0.35
104 0.4
105 0.43
106 0.39
107 0.35
108 0.33
109 0.33
110 0.32
111 0.3
112 0.28
113 0.21
114 0.17
115 0.17
116 0.16
117 0.17
118 0.19
119 0.23
120 0.22
121 0.29
122 0.31
123 0.35
124 0.4
125 0.4
126 0.36
127 0.32
128 0.29
129 0.23
130 0.22
131 0.19
132 0.16
133 0.18
134 0.22
135 0.22
136 0.22
137 0.22
138 0.2
139 0.17
140 0.18
141 0.16
142 0.11
143 0.11
144 0.11
145 0.1
146 0.1
147 0.13
148 0.11
149 0.12
150 0.13
151 0.14
152 0.17
153 0.2
154 0.21
155 0.18
156 0.17
157 0.17
158 0.16
159 0.17
160 0.14
161 0.11
162 0.09
163 0.09
164 0.11
165 0.1
166 0.1
167 0.09
168 0.08
169 0.09
170 0.1
171 0.1
172 0.08
173 0.08
174 0.08
175 0.07
176 0.09
177 0.1
178 0.13
179 0.13
180 0.14
181 0.14
182 0.16
183 0.17
184 0.19
185 0.23
186 0.27
187 0.3
188 0.33
189 0.32
190 0.39
191 0.37
192 0.35
193 0.37
194 0.33
195 0.31
196 0.27
197 0.28
198 0.27
199 0.36
200 0.4
201 0.34
202 0.32
203 0.33
204 0.34
205 0.34
206 0.29
207 0.26
208 0.23
209 0.26
210 0.29
211 0.27
212 0.26
213 0.26
214 0.26
215 0.2
216 0.2
217 0.23
218 0.23
219 0.29
220 0.36
221 0.45
222 0.53
223 0.6
224 0.67
225 0.7
226 0.76
227 0.8
228 0.83
229 0.76
230 0.72
231 0.66
232 0.59
233 0.5
234 0.42
235 0.32
236 0.25
237 0.21
238 0.17
239 0.18
240 0.15
241 0.15
242 0.17
243 0.16
244 0.14
245 0.17
246 0.17
247 0.13
248 0.13
249 0.13
250 0.11
251 0.1
252 0.1
253 0.07
254 0.08
255 0.07
256 0.07
257 0.08
258 0.09
259 0.11
260 0.1
261 0.09
262 0.09
263 0.1
264 0.11
265 0.13
266 0.17
267 0.16
268 0.19
269 0.22
270 0.23
271 0.24
272 0.26
273 0.26
274 0.23
275 0.24
276 0.21
277 0.2
278 0.19
279 0.22
280 0.24