Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4UHI8

Protein Details
Accession G4UHI8    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
57-84HNSGVTKKNKKKQLSSKARKRQEKSMDRHydrophilic
NLS Segment(s)
PositionSequence
16-18RKH
63-80KKNKKKQLSSKARKRQEK
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MAKGTIGKANKAAAVRKHSRAARRQTSPGIDLDKSLKAVRPPQESVNLRPTVLAAHHNSGVTKKNKKKQLSSKARKRQEKSMDRAEAIMDRTSTKVAKSHGKARVIESRKRTWDEVNVVALAEIGKELPTKKEKKADMEKRAEDEAVRAFYADDDEDMDKDGSEWEDDVEGMDQNAAVESLMAAATIPAVAPAMQDDDEEIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.5
4 0.56
5 0.59
6 0.64
7 0.67
8 0.71
9 0.71
10 0.71
11 0.72
12 0.71
13 0.69
14 0.62
15 0.57
16 0.51
17 0.42
18 0.37
19 0.34
20 0.29
21 0.26
22 0.25
23 0.24
24 0.23
25 0.3
26 0.35
27 0.38
28 0.4
29 0.41
30 0.49
31 0.5
32 0.51
33 0.51
34 0.45
35 0.39
36 0.36
37 0.32
38 0.24
39 0.22
40 0.22
41 0.17
42 0.18
43 0.19
44 0.2
45 0.2
46 0.21
47 0.27
48 0.3
49 0.37
50 0.43
51 0.5
52 0.59
53 0.65
54 0.73
55 0.76
56 0.8
57 0.81
58 0.83
59 0.86
60 0.88
61 0.91
62 0.9
63 0.83
64 0.82
65 0.81
66 0.79
67 0.75
68 0.74
69 0.67
70 0.58
71 0.54
72 0.45
73 0.36
74 0.28
75 0.22
76 0.13
77 0.11
78 0.11
79 0.12
80 0.12
81 0.1
82 0.11
83 0.14
84 0.21
85 0.23
86 0.3
87 0.35
88 0.38
89 0.39
90 0.4
91 0.46
92 0.44
93 0.47
94 0.44
95 0.44
96 0.45
97 0.47
98 0.45
99 0.38
100 0.38
101 0.37
102 0.33
103 0.28
104 0.24
105 0.21
106 0.19
107 0.17
108 0.11
109 0.06
110 0.04
111 0.03
112 0.03
113 0.05
114 0.06
115 0.1
116 0.19
117 0.23
118 0.28
119 0.36
120 0.39
121 0.47
122 0.57
123 0.63
124 0.65
125 0.69
126 0.67
127 0.63
128 0.61
129 0.52
130 0.41
131 0.33
132 0.26
133 0.2
134 0.17
135 0.13
136 0.12
137 0.11
138 0.13
139 0.11
140 0.08
141 0.09
142 0.09
143 0.09
144 0.11
145 0.11
146 0.1
147 0.1
148 0.11
149 0.09
150 0.09
151 0.09
152 0.08
153 0.08
154 0.08
155 0.09
156 0.08
157 0.08
158 0.07
159 0.07
160 0.06
161 0.06
162 0.06
163 0.05
164 0.04
165 0.04
166 0.04
167 0.04
168 0.04
169 0.04
170 0.04
171 0.03
172 0.04
173 0.04
174 0.04
175 0.03
176 0.04
177 0.04
178 0.04
179 0.06
180 0.09
181 0.09
182 0.09