Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4UL20

Protein Details
Accession G4UL20    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
22-47APHGCGNKNRKKEKFTKSRKSNIPSYHydrophilic
NLS Segment(s)
PositionSequence
31-39RKKEKFTKS
Subcellular Location(s) mito 9, cyto_mito 8, extr 7, nucl 5, cyto 5
Family & Domain DBs
Amino Acid Sequences MLPATAGVAGLPCHGTVRAGMAPHGCGNKNRKKEKFTKSRKSNIPSYALCPTSNAIKLPFTALTAFVPSSLPRFPRHVLRSDLSDSSPQFLQVNARDDILGDTCSARNTESFVQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.08
4 0.12
5 0.14
6 0.13
7 0.15
8 0.15
9 0.17
10 0.19
11 0.23
12 0.2
13 0.24
14 0.33
15 0.41
16 0.5
17 0.58
18 0.61
19 0.66
20 0.74
21 0.79
22 0.8
23 0.82
24 0.84
25 0.83
26 0.86
27 0.86
28 0.82
29 0.78
30 0.72
31 0.67
32 0.57
33 0.51
34 0.46
35 0.39
36 0.33
37 0.26
38 0.23
39 0.19
40 0.19
41 0.16
42 0.13
43 0.12
44 0.12
45 0.13
46 0.12
47 0.09
48 0.09
49 0.09
50 0.08
51 0.09
52 0.08
53 0.07
54 0.08
55 0.07
56 0.09
57 0.11
58 0.12
59 0.14
60 0.18
61 0.2
62 0.29
63 0.32
64 0.35
65 0.38
66 0.38
67 0.4
68 0.39
69 0.38
70 0.31
71 0.32
72 0.27
73 0.25
74 0.23
75 0.2
76 0.16
77 0.16
78 0.2
79 0.2
80 0.24
81 0.22
82 0.22
83 0.21
84 0.21
85 0.22
86 0.18
87 0.14
88 0.11
89 0.12
90 0.12
91 0.14
92 0.14
93 0.13
94 0.12
95 0.16