Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5WGC8

Protein Details
Accession K5WGC8    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-35EELVKKKKIPMKKLERPITCRNSHydrophilic
NLS Segment(s)
PositionSequence
18-21KKKI
Subcellular Location(s) nucl 13, cyto 8, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
KEGG abp:AGABI1DRAFT48212  -  
Pfam View protein in Pfam  
PF08284  RVP_2  
CDD cd00303  retropepsin_like  
Amino Acid Sequences MVDSGCTHTCIDEELVKKKKIPMKKLERPITCRNSDGTIAGKKDITKFVKMDLNINGHNEQLDAVVTPLQSSDLFLGHDWLTNHNPET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.35
3 0.37
4 0.39
5 0.43
6 0.48
7 0.51
8 0.56
9 0.58
10 0.62
11 0.71
12 0.79
13 0.82
14 0.81
15 0.8
16 0.8
17 0.76
18 0.68
19 0.59
20 0.5
21 0.43
22 0.37
23 0.31
24 0.25
25 0.22
26 0.2
27 0.2
28 0.19
29 0.17
30 0.18
31 0.24
32 0.22
33 0.21
34 0.21
35 0.23
36 0.26
37 0.26
38 0.27
39 0.24
40 0.26
41 0.24
42 0.26
43 0.24
44 0.2
45 0.19
46 0.16
47 0.12
48 0.09
49 0.08
50 0.05
51 0.05
52 0.06
53 0.06
54 0.06
55 0.06
56 0.07
57 0.07
58 0.08
59 0.08
60 0.08
61 0.09
62 0.09
63 0.12
64 0.11
65 0.14
66 0.14
67 0.18
68 0.21