Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5Y804

Protein Details
Accession K5Y804   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
55-90HSSVPDKIQPKKKRRVWNFAERIMRRPRKNNGPVLEHydrophilic
NLS Segment(s)
PositionSequence
64-83PKKKRRVWNFAERIMRRPRK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
KEGG abp:AGABI1DRAFT110934  -  
Amino Acid Sequences MPPPAYSLEAERPYQTEDLRQEVTSVINPPSGTGANSQENRYAASSNEAVRQENHSSVPDKIQPKKKRRVWNFAERIMRRPRKNNGPVLEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.27
3 0.26
4 0.25
5 0.28
6 0.29
7 0.28
8 0.25
9 0.23
10 0.23
11 0.19
12 0.18
13 0.14
14 0.14
15 0.13
16 0.13
17 0.14
18 0.13
19 0.12
20 0.12
21 0.15
22 0.19
23 0.21
24 0.22
25 0.22
26 0.22
27 0.22
28 0.21
29 0.18
30 0.12
31 0.13
32 0.14
33 0.12
34 0.16
35 0.16
36 0.16
37 0.16
38 0.2
39 0.19
40 0.19
41 0.19
42 0.17
43 0.18
44 0.18
45 0.21
46 0.23
47 0.28
48 0.35
49 0.44
50 0.52
51 0.6
52 0.7
53 0.75
54 0.8
55 0.82
56 0.85
57 0.83
58 0.85
59 0.83
60 0.8
61 0.82
62 0.73
63 0.72
64 0.72
65 0.73
66 0.7
67 0.71
68 0.72
69 0.73
70 0.8
71 0.82