Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5WHF5

Protein Details
Accession K5WHF5    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-35DEELVKKKKIPTKKLERPITCRNSHydrophilic
NLS Segment(s)
PositionSequence
18-21KKKI
Subcellular Location(s) cyto 11.5, cyto_nucl 11, nucl 9.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
KEGG abp:AGABI1DRAFT25545  -  
Pfam View protein in Pfam  
PF08284  RVP_2  
CDD cd00303  retropepsin_like  
Amino Acid Sequences MVYSGCTHTCIDEELVKKKKIPTKKLERPITCRNSDGTIAGKKDITKFVKMDLNINGHNKQLDAVVTPLQSSDLFVGHDWLTNHNPEIDWKQGIIKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.37
3 0.38
4 0.4
5 0.45
6 0.5
7 0.55
8 0.6
9 0.62
10 0.66
11 0.75
12 0.82
13 0.85
14 0.84
15 0.82
16 0.83
17 0.8
18 0.7
19 0.61
20 0.53
21 0.45
22 0.39
23 0.33
24 0.26
25 0.23
26 0.21
27 0.21
28 0.2
29 0.18
30 0.19
31 0.25
32 0.23
33 0.22
34 0.22
35 0.24
36 0.26
37 0.26
38 0.27
39 0.23
40 0.24
41 0.24
42 0.27
43 0.25
44 0.22
45 0.22
46 0.19
47 0.16
48 0.13
49 0.11
50 0.08
51 0.09
52 0.1
53 0.1
54 0.1
55 0.09
56 0.1
57 0.09
58 0.09
59 0.08
60 0.07
61 0.08
62 0.08
63 0.11
64 0.1
65 0.13
66 0.13
67 0.16
68 0.19
69 0.2
70 0.21
71 0.19
72 0.2
73 0.22
74 0.26
75 0.26
76 0.24
77 0.23