Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5Y3H5

Protein Details
Accession K5Y3H5    Localization Confidence High Confidence Score 19.4
NoLS Segment(s)
PositionSequenceProtein Nature
292-313QSNSKRKAPKKSAEVTTKKRKIHydrophilic
400-427IVTRGAGFRKEKNKKKKGSYKGGEITMQHydrophilic
NLS Segment(s)
PositionSequence
243-256RPKAKVKGKVPGKN
296-311KRKAPKKSAEVTTKKR
406-418GFRKEKNKKKKGS
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006594  LisH  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
KEGG abp:AGABI1DRAFT111108  -  
Pfam View protein in Pfam  
PF05022  SRP40_C  
PROSITE View protein in PROSITE  
PS50896  LISH  
Amino Acid Sequences MDRNLATTYTLVYAFLTDKSLKKTAQALKKEVRDVVVLKDGLKLESPSLEVILQQWKAQEEQKNKPTPSSKVDSSSPSDSSGSDSDSSSDSDSDSDSDHTATKTKAPAKAQSHVKKKEASSDSSDSSESDGESSSESEDESNNPGSNIKSKTKTSPPKVTLNGSDSSKTLSTGEGSSSESDNDSDSSSSSGSSSDSDSSSTSTVQLKKKPIASSAQKANKDADSSSSSSDAGSDSTGEPEAERPKAKVKGKVPGKNTKAPPSSNSSNSSESDSDSDSSSSSDSDSDADSEPQSNSKRKAPKKSAEVTTKKRKISDDGAAVATATSGTVPEPASVNRRTNEESLPSGHSNKNGGKKGPQNGVRFQRIKDESVMADSIVDNRYEIKAKPSNDYGQRAHADLIVTRGAGFRKEKNKKKKGSYKGGEITMQSHSFKFTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.15
4 0.17
5 0.21
6 0.27
7 0.31
8 0.3
9 0.33
10 0.42
11 0.47
12 0.53
13 0.57
14 0.6
15 0.64
16 0.7
17 0.71
18 0.64
19 0.56
20 0.51
21 0.45
22 0.4
23 0.39
24 0.33
25 0.29
26 0.31
27 0.3
28 0.26
29 0.26
30 0.23
31 0.17
32 0.18
33 0.19
34 0.15
35 0.15
36 0.14
37 0.12
38 0.14
39 0.19
40 0.19
41 0.19
42 0.2
43 0.2
44 0.23
45 0.29
46 0.35
47 0.36
48 0.46
49 0.54
50 0.61
51 0.61
52 0.65
53 0.65
54 0.63
55 0.62
56 0.59
57 0.53
58 0.49
59 0.52
60 0.49
61 0.48
62 0.47
63 0.4
64 0.35
65 0.32
66 0.28
67 0.28
68 0.24
69 0.21
70 0.18
71 0.17
72 0.16
73 0.16
74 0.17
75 0.14
76 0.14
77 0.11
78 0.11
79 0.11
80 0.11
81 0.11
82 0.11
83 0.11
84 0.11
85 0.13
86 0.13
87 0.15
88 0.15
89 0.18
90 0.24
91 0.28
92 0.33
93 0.36
94 0.44
95 0.46
96 0.54
97 0.6
98 0.63
99 0.68
100 0.69
101 0.69
102 0.65
103 0.61
104 0.63
105 0.57
106 0.52
107 0.49
108 0.46
109 0.44
110 0.4
111 0.39
112 0.29
113 0.26
114 0.22
115 0.15
116 0.11
117 0.09
118 0.08
119 0.09
120 0.09
121 0.08
122 0.07
123 0.07
124 0.08
125 0.08
126 0.09
127 0.11
128 0.13
129 0.12
130 0.12
131 0.13
132 0.14
133 0.19
134 0.23
135 0.26
136 0.29
137 0.31
138 0.37
139 0.46
140 0.56
141 0.58
142 0.63
143 0.61
144 0.64
145 0.65
146 0.62
147 0.56
148 0.49
149 0.45
150 0.36
151 0.32
152 0.25
153 0.24
154 0.2
155 0.17
156 0.14
157 0.11
158 0.11
159 0.1
160 0.11
161 0.09
162 0.1
163 0.11
164 0.11
165 0.11
166 0.1
167 0.1
168 0.1
169 0.09
170 0.09
171 0.08
172 0.07
173 0.08
174 0.07
175 0.07
176 0.07
177 0.06
178 0.06
179 0.07
180 0.08
181 0.08
182 0.09
183 0.09
184 0.09
185 0.1
186 0.1
187 0.1
188 0.1
189 0.14
190 0.2
191 0.23
192 0.28
193 0.31
194 0.34
195 0.39
196 0.38
197 0.36
198 0.38
199 0.39
200 0.4
201 0.45
202 0.48
203 0.45
204 0.45
205 0.44
206 0.37
207 0.32
208 0.27
209 0.21
210 0.17
211 0.17
212 0.16
213 0.15
214 0.15
215 0.13
216 0.13
217 0.1
218 0.07
219 0.06
220 0.06
221 0.06
222 0.06
223 0.07
224 0.07
225 0.07
226 0.09
227 0.12
228 0.14
229 0.14
230 0.15
231 0.21
232 0.29
233 0.33
234 0.38
235 0.39
236 0.46
237 0.55
238 0.6
239 0.61
240 0.63
241 0.64
242 0.64
243 0.65
244 0.64
245 0.59
246 0.54
247 0.5
248 0.48
249 0.47
250 0.42
251 0.43
252 0.38
253 0.36
254 0.35
255 0.36
256 0.29
257 0.25
258 0.23
259 0.2
260 0.17
261 0.15
262 0.14
263 0.11
264 0.11
265 0.1
266 0.09
267 0.08
268 0.07
269 0.07
270 0.07
271 0.08
272 0.09
273 0.09
274 0.1
275 0.11
276 0.12
277 0.12
278 0.16
279 0.2
280 0.24
281 0.27
282 0.33
283 0.43
284 0.49
285 0.6
286 0.65
287 0.69
288 0.72
289 0.77
290 0.78
291 0.79
292 0.8
293 0.79
294 0.81
295 0.79
296 0.73
297 0.69
298 0.63
299 0.59
300 0.56
301 0.53
302 0.47
303 0.42
304 0.4
305 0.35
306 0.32
307 0.26
308 0.19
309 0.11
310 0.06
311 0.04
312 0.03
313 0.04
314 0.06
315 0.06
316 0.07
317 0.09
318 0.11
319 0.17
320 0.22
321 0.27
322 0.27
323 0.31
324 0.34
325 0.36
326 0.37
327 0.35
328 0.32
329 0.3
330 0.34
331 0.33
332 0.33
333 0.32
334 0.32
335 0.34
336 0.37
337 0.43
338 0.43
339 0.44
340 0.47
341 0.53
342 0.58
343 0.61
344 0.63
345 0.59
346 0.63
347 0.69
348 0.7
349 0.66
350 0.59
351 0.6
352 0.55
353 0.53
354 0.47
355 0.42
356 0.33
357 0.33
358 0.32
359 0.22
360 0.19
361 0.17
362 0.17
363 0.15
364 0.14
365 0.1
366 0.12
367 0.15
368 0.17
369 0.18
370 0.24
371 0.29
372 0.31
373 0.37
374 0.41
375 0.47
376 0.52
377 0.58
378 0.52
379 0.53
380 0.53
381 0.48
382 0.43
383 0.37
384 0.3
385 0.24
386 0.25
387 0.18
388 0.16
389 0.15
390 0.16
391 0.16
392 0.2
393 0.24
394 0.29
395 0.4
396 0.5
397 0.61
398 0.69
399 0.78
400 0.83
401 0.9
402 0.92
403 0.91
404 0.92
405 0.9
406 0.89
407 0.86
408 0.81
409 0.73
410 0.64
411 0.56
412 0.5
413 0.46
414 0.37
415 0.3