Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5WT05

Protein Details
Accession K5WT05    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-35DEELVKKKKIPTKKLERPITCRNSHydrophilic
NLS Segment(s)
PositionSequence
18-21KKKI
Subcellular Location(s) nucl 14, cyto 8, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR032567  LDOC1-rel  
IPR021109  Peptidase_aspartic_dom_sf  
KEGG abp:AGABI1DRAFT27621  -  
Pfam View protein in Pfam  
PF08284  RVP_2  
CDD cd00303  retropepsin_like  
Amino Acid Sequences MVDSGCTHTCIDEELVKKKKIPTKKLERPITCRNSDGTIAGKKDITKFVKMDLNINGHNEQLNAVVTPLQSSDLFLGHDWLTNHNPEIDWKQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.35
3 0.37
4 0.4
5 0.45
6 0.5
7 0.54
8 0.6
9 0.62
10 0.66
11 0.75
12 0.82
13 0.85
14 0.84
15 0.82
16 0.83
17 0.79
18 0.7
19 0.61
20 0.52
21 0.45
22 0.39
23 0.32
24 0.26
25 0.22
26 0.21
27 0.2
28 0.19
29 0.18
30 0.19
31 0.24
32 0.23
33 0.22
34 0.21
35 0.23
36 0.26
37 0.25
38 0.27
39 0.23
40 0.24
41 0.23
42 0.25
43 0.23
44 0.19
45 0.19
46 0.16
47 0.13
48 0.1
49 0.1
50 0.07
51 0.07
52 0.07
53 0.07
54 0.07
55 0.07
56 0.08
57 0.08
58 0.09
59 0.09
60 0.09
61 0.1
62 0.1
63 0.12
64 0.1
65 0.13
66 0.13
67 0.17
68 0.2
69 0.21
70 0.22
71 0.21
72 0.21
73 0.23