Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WWT3

Protein Details
Accession K5WWT3    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
31-55DEDIKKENAQRREERKREVRANPVMHydrophilic
359-384NYFKSHFQQVHRKKDPWKRSLWLHYTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9mito 9mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001019  Gprotein_alpha_su  
IPR011025  GproteinA_insert  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0031683  F:G-protein beta/gamma-subunit complex binding  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0007186  P:G protein-coupled receptor signaling pathway  
KEGG abp:AGABI1DRAFT132402  -  
Pfam View protein in Pfam  
PF00503  G-alpha  
PROSITE View protein in PROSITE  
PS51882  G_ALPHA  
Amino Acid Sequences MTRRASINSFTAPMTAAPPKDNADARNRLIDEDIKKENAQRREERKREVRANPVMLLGQAESGKSTLQKQFQIYYAFKSLERERPCWKPVVFFNIIKALRVIFNELEYRFSEYGNQSLEAPLAVQNQLSELRTKLLPLISLEDSLASQLNGGVTIGSGGQTGAFVRSGWQTLVGGTSESDVQVAEAVARTVEVSTLTAKTLASSLSDIQTLWRHPTVKLLFQDRKVRLEESAPFFLDEIDRISEPDYVPTTDDILNVRLQTLGIMEHSFPVTMGGLSYNWKLYDVGGAYLEEDSKVNRIEDSLQLFSAICSSKLLKDADLVLLLNKADLLKKKLAAGILIRQFITSYGDRANNFEAASNYFKSHFQQVHRKKDPWKRSLWLHYTTMLDVKATQKIISNVGEAIIRKHIAEIGLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.22
4 0.22
5 0.24
6 0.27
7 0.32
8 0.35
9 0.35
10 0.39
11 0.45
12 0.45
13 0.51
14 0.48
15 0.43
16 0.43
17 0.45
18 0.4
19 0.39
20 0.41
21 0.36
22 0.37
23 0.43
24 0.48
25 0.49
26 0.53
27 0.57
28 0.63
29 0.71
30 0.78
31 0.81
32 0.82
33 0.84
34 0.85
35 0.82
36 0.82
37 0.79
38 0.75
39 0.66
40 0.58
41 0.49
42 0.39
43 0.32
44 0.22
45 0.16
46 0.12
47 0.11
48 0.1
49 0.1
50 0.11
51 0.11
52 0.17
53 0.21
54 0.26
55 0.31
56 0.33
57 0.36
58 0.39
59 0.44
60 0.39
61 0.38
62 0.37
63 0.33
64 0.31
65 0.34
66 0.35
67 0.37
68 0.41
69 0.41
70 0.43
71 0.49
72 0.51
73 0.53
74 0.48
75 0.45
76 0.44
77 0.48
78 0.48
79 0.42
80 0.42
81 0.43
82 0.42
83 0.37
84 0.33
85 0.25
86 0.21
87 0.21
88 0.22
89 0.14
90 0.16
91 0.19
92 0.19
93 0.2
94 0.19
95 0.24
96 0.21
97 0.2
98 0.23
99 0.2
100 0.23
101 0.22
102 0.22
103 0.17
104 0.17
105 0.17
106 0.12
107 0.11
108 0.1
109 0.1
110 0.1
111 0.09
112 0.08
113 0.1
114 0.12
115 0.12
116 0.11
117 0.1
118 0.12
119 0.13
120 0.13
121 0.14
122 0.13
123 0.13
124 0.13
125 0.16
126 0.15
127 0.15
128 0.15
129 0.13
130 0.12
131 0.11
132 0.1
133 0.06
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.04
140 0.03
141 0.04
142 0.04
143 0.03
144 0.03
145 0.03
146 0.03
147 0.04
148 0.04
149 0.04
150 0.05
151 0.04
152 0.06
153 0.07
154 0.08
155 0.08
156 0.08
157 0.08
158 0.07
159 0.08
160 0.07
161 0.06
162 0.06
163 0.06
164 0.06
165 0.06
166 0.05
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.03
175 0.03
176 0.04
177 0.03
178 0.04
179 0.03
180 0.04
181 0.05
182 0.06
183 0.06
184 0.07
185 0.07
186 0.07
187 0.07
188 0.06
189 0.06
190 0.06
191 0.07
192 0.07
193 0.08
194 0.07
195 0.08
196 0.1
197 0.11
198 0.12
199 0.14
200 0.14
201 0.14
202 0.22
203 0.23
204 0.26
205 0.28
206 0.34
207 0.35
208 0.39
209 0.48
210 0.42
211 0.43
212 0.4
213 0.38
214 0.31
215 0.3
216 0.3
217 0.26
218 0.27
219 0.23
220 0.22
221 0.21
222 0.2
223 0.17
224 0.12
225 0.09
226 0.08
227 0.08
228 0.08
229 0.09
230 0.11
231 0.1
232 0.12
233 0.12
234 0.11
235 0.12
236 0.12
237 0.13
238 0.12
239 0.13
240 0.12
241 0.12
242 0.13
243 0.12
244 0.12
245 0.09
246 0.09
247 0.08
248 0.07
249 0.06
250 0.06
251 0.07
252 0.07
253 0.07
254 0.08
255 0.07
256 0.07
257 0.07
258 0.06
259 0.05
260 0.05
261 0.05
262 0.06
263 0.08
264 0.09
265 0.09
266 0.09
267 0.1
268 0.1
269 0.09
270 0.13
271 0.11
272 0.11
273 0.11
274 0.11
275 0.11
276 0.11
277 0.11
278 0.07
279 0.07
280 0.07
281 0.09
282 0.1
283 0.1
284 0.09
285 0.11
286 0.12
287 0.17
288 0.2
289 0.19
290 0.18
291 0.18
292 0.18
293 0.17
294 0.18
295 0.14
296 0.1
297 0.11
298 0.12
299 0.14
300 0.18
301 0.19
302 0.16
303 0.17
304 0.19
305 0.18
306 0.17
307 0.16
308 0.12
309 0.12
310 0.12
311 0.1
312 0.09
313 0.08
314 0.12
315 0.16
316 0.21
317 0.23
318 0.25
319 0.27
320 0.29
321 0.29
322 0.28
323 0.27
324 0.3
325 0.31
326 0.32
327 0.3
328 0.27
329 0.27
330 0.24
331 0.25
332 0.18
333 0.16
334 0.19
335 0.23
336 0.23
337 0.27
338 0.29
339 0.25
340 0.24
341 0.24
342 0.21
343 0.2
344 0.24
345 0.22
346 0.22
347 0.22
348 0.23
349 0.24
350 0.31
351 0.33
352 0.37
353 0.47
354 0.55
355 0.65
356 0.71
357 0.75
358 0.77
359 0.82
360 0.84
361 0.81
362 0.79
363 0.75
364 0.76
365 0.8
366 0.77
367 0.72
368 0.64
369 0.6
370 0.54
371 0.48
372 0.42
373 0.32
374 0.25
375 0.22
376 0.23
377 0.25
378 0.24
379 0.23
380 0.24
381 0.26
382 0.31
383 0.3
384 0.28
385 0.23
386 0.23
387 0.25
388 0.21
389 0.21
390 0.22
391 0.21
392 0.19
393 0.2
394 0.21