Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5W0T0

Protein Details
Accession K5W0T0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-34AQALEKEKSRRKRSIWIVVAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, plas 7, mito 4, golg 2, vacu 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000490  Glyco_hydro_17  
IPR017853  Glycoside_hydrolase_SF  
Gene Ontology GO:0016020  C:membrane  
GO:0004553  F:hydrolase activity, hydrolyzing O-glycosyl compounds  
GO:0005975  P:carbohydrate metabolic process  
KEGG abp:AGABI1DRAFT113592  -  
Pfam View protein in Pfam  
PF00332  Glyco_hydro_17  
Amino Acid Sequences MEEKYQHLEGSGGMAQALEKEKSRRKRSIWIVVASVVGILVLVAVAVIAWYFSTHKNNGSNGSGGNPGKSGDSTGNNTPNDGSDPSIFELDSRLHKSFYGMAYTPEGSQLPNCGNSLENVIKDIQILSQLTTRVRLYGADCNQSALVLEAIKQTKVDMQVFLGNYPIPDDNTPYERQRDIIKEALQTYGADHVAGVTVGNEFMLNYLTGQGVQDPNGIIGQQGAAILKANIEDTRQMIDGLQLSKHIPVGNSDAGSFFSNSVLTDVEYGMSNVHAWFANTTAEGAAPWVFQFFDENNVQPAALLPNKPKMYIAETGWPTKSSDAGNANNGGSDASVPNLQVFIDNFVCQANSNNVGYFFFEYFDEQWKDAMFGGVEGWWGLFNADRTLKDITIPDCPAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.15
4 0.18
5 0.16
6 0.18
7 0.27
8 0.37
9 0.47
10 0.56
11 0.62
12 0.64
13 0.73
14 0.78
15 0.81
16 0.79
17 0.73
18 0.66
19 0.58
20 0.53
21 0.42
22 0.31
23 0.2
24 0.12
25 0.07
26 0.04
27 0.03
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.04
38 0.06
39 0.11
40 0.17
41 0.19
42 0.25
43 0.3
44 0.33
45 0.36
46 0.37
47 0.34
48 0.29
49 0.29
50 0.31
51 0.27
52 0.25
53 0.21
54 0.19
55 0.18
56 0.18
57 0.18
58 0.15
59 0.19
60 0.23
61 0.28
62 0.35
63 0.33
64 0.34
65 0.32
66 0.29
67 0.28
68 0.24
69 0.2
70 0.15
71 0.17
72 0.18
73 0.18
74 0.16
75 0.13
76 0.14
77 0.14
78 0.19
79 0.22
80 0.22
81 0.21
82 0.22
83 0.24
84 0.26
85 0.25
86 0.24
87 0.2
88 0.2
89 0.23
90 0.24
91 0.22
92 0.19
93 0.18
94 0.13
95 0.13
96 0.14
97 0.13
98 0.14
99 0.14
100 0.13
101 0.13
102 0.13
103 0.18
104 0.17
105 0.15
106 0.15
107 0.15
108 0.15
109 0.15
110 0.14
111 0.09
112 0.1
113 0.1
114 0.1
115 0.12
116 0.14
117 0.14
118 0.16
119 0.16
120 0.14
121 0.14
122 0.14
123 0.15
124 0.21
125 0.24
126 0.25
127 0.25
128 0.25
129 0.25
130 0.23
131 0.2
132 0.12
133 0.1
134 0.06
135 0.07
136 0.1
137 0.11
138 0.11
139 0.11
140 0.1
141 0.13
142 0.16
143 0.17
144 0.13
145 0.13
146 0.17
147 0.17
148 0.17
149 0.15
150 0.11
151 0.1
152 0.11
153 0.1
154 0.08
155 0.08
156 0.1
157 0.12
158 0.16
159 0.19
160 0.19
161 0.22
162 0.21
163 0.22
164 0.24
165 0.25
166 0.24
167 0.26
168 0.26
169 0.25
170 0.26
171 0.25
172 0.21
173 0.18
174 0.15
175 0.12
176 0.1
177 0.08
178 0.07
179 0.06
180 0.06
181 0.05
182 0.05
183 0.03
184 0.03
185 0.03
186 0.03
187 0.03
188 0.03
189 0.03
190 0.04
191 0.03
192 0.03
193 0.04
194 0.04
195 0.05
196 0.05
197 0.06
198 0.06
199 0.06
200 0.07
201 0.06
202 0.07
203 0.07
204 0.07
205 0.05
206 0.05
207 0.04
208 0.04
209 0.04
210 0.04
211 0.04
212 0.04
213 0.04
214 0.04
215 0.04
216 0.05
217 0.05
218 0.06
219 0.07
220 0.07
221 0.09
222 0.09
223 0.09
224 0.08
225 0.09
226 0.11
227 0.11
228 0.11
229 0.1
230 0.1
231 0.11
232 0.12
233 0.12
234 0.1
235 0.11
236 0.15
237 0.16
238 0.16
239 0.15
240 0.14
241 0.15
242 0.15
243 0.14
244 0.09
245 0.08
246 0.08
247 0.08
248 0.08
249 0.07
250 0.07
251 0.07
252 0.07
253 0.07
254 0.07
255 0.07
256 0.06
257 0.06
258 0.06
259 0.05
260 0.07
261 0.06
262 0.06
263 0.07
264 0.07
265 0.08
266 0.08
267 0.08
268 0.07
269 0.07
270 0.06
271 0.07
272 0.06
273 0.06
274 0.06
275 0.06
276 0.06
277 0.06
278 0.09
279 0.08
280 0.13
281 0.15
282 0.15
283 0.17
284 0.17
285 0.17
286 0.14
287 0.14
288 0.14
289 0.15
290 0.17
291 0.19
292 0.27
293 0.28
294 0.29
295 0.29
296 0.27
297 0.28
298 0.3
299 0.29
300 0.29
301 0.31
302 0.35
303 0.35
304 0.33
305 0.3
306 0.26
307 0.26
308 0.18
309 0.22
310 0.24
311 0.26
312 0.28
313 0.3
314 0.29
315 0.26
316 0.25
317 0.19
318 0.13
319 0.12
320 0.09
321 0.08
322 0.09
323 0.09
324 0.09
325 0.09
326 0.09
327 0.1
328 0.1
329 0.13
330 0.14
331 0.14
332 0.14
333 0.14
334 0.15
335 0.13
336 0.16
337 0.16
338 0.18
339 0.19
340 0.19
341 0.2
342 0.2
343 0.22
344 0.22
345 0.18
346 0.15
347 0.15
348 0.17
349 0.18
350 0.25
351 0.26
352 0.23
353 0.24
354 0.23
355 0.23
356 0.21
357 0.21
358 0.13
359 0.1
360 0.1
361 0.1
362 0.09
363 0.08
364 0.08
365 0.06
366 0.06
367 0.06
368 0.08
369 0.09
370 0.15
371 0.19
372 0.19
373 0.23
374 0.26
375 0.26
376 0.27
377 0.3
378 0.27
379 0.31