Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5XTD5

Protein Details
Accession K5XTD5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
4-25RVTLRTRKSYNTKSNLRRIVKTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG abp:AGABI1DRAFT85942  -  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
Amino Acid Sequences MAQRVTLRTRKSYNTKSNLRRIVKTPGGKLVYHHLKKRGTAPKCGDCGLALPGVPALRPRAYASISKRKKTVQRAYGGSRCGDCVKSRILRAFLVEEAKIVKKVIKQQAATTRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.78
3 0.79
4 0.84
5 0.85
6 0.8
7 0.74
8 0.68
9 0.68
10 0.66
11 0.63
12 0.56
13 0.54
14 0.51
15 0.47
16 0.44
17 0.45
18 0.47
19 0.46
20 0.48
21 0.47
22 0.47
23 0.48
24 0.57
25 0.56
26 0.49
27 0.52
28 0.55
29 0.54
30 0.54
31 0.52
32 0.43
33 0.33
34 0.31
35 0.23
36 0.17
37 0.1
38 0.08
39 0.08
40 0.07
41 0.07
42 0.07
43 0.08
44 0.08
45 0.09
46 0.1
47 0.11
48 0.13
49 0.19
50 0.25
51 0.34
52 0.4
53 0.41
54 0.43
55 0.47
56 0.53
57 0.58
58 0.61
59 0.58
60 0.59
61 0.62
62 0.67
63 0.65
64 0.59
65 0.5
66 0.41
67 0.35
68 0.3
69 0.26
70 0.21
71 0.19
72 0.24
73 0.27
74 0.3
75 0.33
76 0.33
77 0.32
78 0.33
79 0.33
80 0.29
81 0.28
82 0.24
83 0.2
84 0.2
85 0.21
86 0.2
87 0.18
88 0.19
89 0.21
90 0.31
91 0.4
92 0.45
93 0.45
94 0.52