Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K5X360

Protein Details
Accession K5X360    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
35-69ENHHGYRKTKRTKVCCRNGKRVWLGGRKKRRQAVEBasic
NLS Segment(s)
PositionSequence
58-65LGGRKKRR
Subcellular Location(s) mito 13, cyto 10.5, cyto_nucl 7.5, nucl 3.5
Family & Domain DBs
KEGG abp:AGABI1DRAFT112320  -  
Amino Acid Sequences MVGESPNKKASLSAEAVRSRLGCEGRAGPPFAVPENHHGYRKTKRTKVCCRNGKRVWLGGRKKRRQAVELLSVVGVRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.34
4 0.34
5 0.3
6 0.25
7 0.25
8 0.22
9 0.16
10 0.17
11 0.2
12 0.22
13 0.24
14 0.24
15 0.2
16 0.2
17 0.2
18 0.18
19 0.17
20 0.14
21 0.18
22 0.23
23 0.25
24 0.26
25 0.26
26 0.3
27 0.36
28 0.45
29 0.48
30 0.48
31 0.55
32 0.63
33 0.73
34 0.78
35 0.81
36 0.82
37 0.81
38 0.85
39 0.82
40 0.81
41 0.74
42 0.7
43 0.68
44 0.68
45 0.7
46 0.7
47 0.76
48 0.76
49 0.8
50 0.81
51 0.78
52 0.72
53 0.7
54 0.68
55 0.66
56 0.58
57 0.51
58 0.44