Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5X4L1

Protein Details
Accession K5X4L1    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
79-98PPPPLPPPPPRKKSKKELDLBasic
119-143LSESEKKDLKRTKRDTVRTRCTFFTHydrophilic
NLS Segment(s)
PositionSequence
70-94APLHPNRKPPPPPLPPPPPRKKSKK
Subcellular Location(s) nucl 19.5, mito_nucl 13.166, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
KEGG abp:AGABI1DRAFT114903  -  
Amino Acid Sequences MSTPSVNKYPSLSSRYSIAPQSQTSGMSELLRRVNSHPTSPFAAGKGSPIPGSAYSPYLKSSRRTLSRIAPLHPNRKPPPPPLPPPPPRKKSKKELDLEEKWEEEIIDDMGGITEWLALSESEKKDLKRTKRDTVRTRCTFFTSIADDSVPVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.37
4 0.35
5 0.33
6 0.32
7 0.3
8 0.32
9 0.3
10 0.28
11 0.26
12 0.23
13 0.2
14 0.18
15 0.18
16 0.18
17 0.21
18 0.21
19 0.22
20 0.23
21 0.31
22 0.31
23 0.34
24 0.32
25 0.31
26 0.34
27 0.35
28 0.33
29 0.24
30 0.24
31 0.19
32 0.19
33 0.18
34 0.15
35 0.13
36 0.12
37 0.13
38 0.12
39 0.14
40 0.13
41 0.14
42 0.13
43 0.14
44 0.16
45 0.18
46 0.19
47 0.2
48 0.25
49 0.3
50 0.35
51 0.37
52 0.38
53 0.42
54 0.48
55 0.47
56 0.44
57 0.46
58 0.47
59 0.53
60 0.52
61 0.54
62 0.48
63 0.53
64 0.55
65 0.51
66 0.55
67 0.53
68 0.56
69 0.56
70 0.63
71 0.64
72 0.7
73 0.74
74 0.72
75 0.75
76 0.78
77 0.78
78 0.79
79 0.8
80 0.8
81 0.77
82 0.78
83 0.78
84 0.73
85 0.71
86 0.62
87 0.52
88 0.43
89 0.36
90 0.26
91 0.17
92 0.13
93 0.08
94 0.06
95 0.05
96 0.05
97 0.05
98 0.05
99 0.04
100 0.03
101 0.03
102 0.03
103 0.03
104 0.04
105 0.04
106 0.06
107 0.14
108 0.15
109 0.2
110 0.23
111 0.24
112 0.33
113 0.42
114 0.5
115 0.54
116 0.61
117 0.67
118 0.74
119 0.84
120 0.85
121 0.87
122 0.88
123 0.85
124 0.82
125 0.74
126 0.7
127 0.61
128 0.52
129 0.47
130 0.41
131 0.35
132 0.32
133 0.29