Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5VFW4

Protein Details
Accession K5VFW4   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPRRCRKRKNAKKRAQECSRLSGBasic
NLS Segment(s)
PositionSequence
6-14RKRKNAKKR
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 8
Family & Domain DBs
KEGG abp:AGABI1DRAFT135398  -  
Amino Acid Sequences MPRRCRKRKNAKKRAQECSRLSGTSKSNVTGPLGHLSGIGAALPAVKTPPTPPVDVSTGTGSPGSDIPLRASALGAYSSPSSSPSSSPSPSSPLQLDADFFWLADTGATSHMTPH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.92
3 0.9
4 0.83
5 0.79
6 0.73
7 0.63
8 0.56
9 0.51
10 0.44
11 0.4
12 0.37
13 0.3
14 0.28
15 0.27
16 0.27
17 0.22
18 0.21
19 0.18
20 0.17
21 0.16
22 0.14
23 0.13
24 0.11
25 0.09
26 0.07
27 0.04
28 0.03
29 0.04
30 0.03
31 0.04
32 0.04
33 0.04
34 0.05
35 0.06
36 0.12
37 0.14
38 0.15
39 0.16
40 0.19
41 0.2
42 0.21
43 0.21
44 0.17
45 0.14
46 0.14
47 0.13
48 0.1
49 0.08
50 0.08
51 0.08
52 0.08
53 0.08
54 0.09
55 0.1
56 0.11
57 0.1
58 0.1
59 0.08
60 0.08
61 0.08
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.09
68 0.11
69 0.11
70 0.12
71 0.15
72 0.2
73 0.21
74 0.24
75 0.24
76 0.27
77 0.27
78 0.29
79 0.26
80 0.25
81 0.25
82 0.23
83 0.22
84 0.18
85 0.21
86 0.17
87 0.15
88 0.13
89 0.1
90 0.1
91 0.09
92 0.08
93 0.06
94 0.08
95 0.1