Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5X0P5

Protein Details
Accession K5X0P5   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
3-27STVVRCSKASRRPLTPKRGNKDYYKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019189  Ribosomal_L27/L41_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG abp:AGABI1DRAFT115590  -  
Pfam View protein in Pfam  
PF09809  MRP-L27  
Amino Acid Sequences MFSTVVRCSKASRRPLTPKRGNKDYYKGTRQAFLPGGHRTGAPGKHVIGGKAKYRLLDEKVRVFVAPPVAEIESSPLKPYVSRSVYLSKKERQAVFGKLPAGGLQGAQLLELARKRMSEAVVKQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.77
3 0.82
4 0.84
5 0.85
6 0.84
7 0.85
8 0.81
9 0.77
10 0.76
11 0.75
12 0.74
13 0.71
14 0.69
15 0.61
16 0.6
17 0.53
18 0.5
19 0.44
20 0.37
21 0.34
22 0.3
23 0.3
24 0.26
25 0.25
26 0.22
27 0.23
28 0.22
29 0.19
30 0.19
31 0.18
32 0.21
33 0.22
34 0.22
35 0.22
36 0.24
37 0.25
38 0.28
39 0.28
40 0.24
41 0.26
42 0.28
43 0.27
44 0.31
45 0.3
46 0.29
47 0.3
48 0.29
49 0.27
50 0.23
51 0.2
52 0.17
53 0.14
54 0.1
55 0.11
56 0.1
57 0.1
58 0.1
59 0.11
60 0.11
61 0.11
62 0.12
63 0.11
64 0.11
65 0.11
66 0.15
67 0.2
68 0.21
69 0.22
70 0.24
71 0.32
72 0.36
73 0.43
74 0.45
75 0.42
76 0.47
77 0.52
78 0.5
79 0.47
80 0.47
81 0.47
82 0.46
83 0.44
84 0.38
85 0.32
86 0.31
87 0.26
88 0.22
89 0.16
90 0.11
91 0.08
92 0.09
93 0.08
94 0.08
95 0.08
96 0.07
97 0.11
98 0.13
99 0.15
100 0.14
101 0.15
102 0.17
103 0.2
104 0.23
105 0.28