Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WMW7

Protein Details
Accession K5WMW7    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
201-223GEPGAPEKGKKKEKKEKEKGEKKBasic
NLS Segment(s)
PositionSequence
206-223PEKGKKKEKKEKEKGEKK
Subcellular Location(s) mito 20, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR034600  MRPL36_yeast  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG abp:AGABI1DRAFT115730  -  
Amino Acid Sequences MQNLTSAGPRILSSSKITSTTSRLPCHCRSASTSSYGRTHVWKRRLPVLPNPIIPKFPQTVIRSDGTSFVQWTTSPRSLIRLTRDTTNNPIWNTGMWISDLRGGLEEENGTTGRMGRFNRKFGTGSPMGVGQVGMKEVEVKETVVVEEATGEKGKKEAEIKSKVKEDMVDLTGMGMGMDMGMGGSLDDVNWYEDMASMTGGEPGAPEKGKKKEKKEKEKGEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.27
4 0.29
5 0.28
6 0.33
7 0.39
8 0.42
9 0.44
10 0.47
11 0.52
12 0.54
13 0.59
14 0.55
15 0.49
16 0.48
17 0.49
18 0.47
19 0.46
20 0.44
21 0.4
22 0.41
23 0.4
24 0.36
25 0.37
26 0.43
27 0.45
28 0.51
29 0.52
30 0.54
31 0.61
32 0.66
33 0.64
34 0.64
35 0.65
36 0.62
37 0.62
38 0.62
39 0.54
40 0.48
41 0.44
42 0.39
43 0.31
44 0.27
45 0.31
46 0.28
47 0.3
48 0.32
49 0.32
50 0.29
51 0.28
52 0.27
53 0.21
54 0.2
55 0.17
56 0.13
57 0.12
58 0.11
59 0.14
60 0.19
61 0.19
62 0.19
63 0.19
64 0.23
65 0.26
66 0.29
67 0.33
68 0.31
69 0.31
70 0.35
71 0.38
72 0.36
73 0.39
74 0.41
75 0.38
76 0.34
77 0.33
78 0.27
79 0.24
80 0.23
81 0.18
82 0.13
83 0.1
84 0.1
85 0.09
86 0.12
87 0.12
88 0.1
89 0.09
90 0.09
91 0.09
92 0.09
93 0.08
94 0.05
95 0.06
96 0.06
97 0.05
98 0.05
99 0.06
100 0.06
101 0.1
102 0.12
103 0.2
104 0.24
105 0.28
106 0.29
107 0.31
108 0.31
109 0.28
110 0.34
111 0.25
112 0.22
113 0.19
114 0.18
115 0.15
116 0.14
117 0.13
118 0.06
119 0.06
120 0.05
121 0.05
122 0.04
123 0.06
124 0.06
125 0.07
126 0.08
127 0.07
128 0.08
129 0.08
130 0.08
131 0.07
132 0.07
133 0.06
134 0.06
135 0.06
136 0.07
137 0.08
138 0.08
139 0.08
140 0.09
141 0.1
142 0.12
143 0.16
144 0.21
145 0.28
146 0.38
147 0.41
148 0.46
149 0.5
150 0.48
151 0.45
152 0.39
153 0.33
154 0.28
155 0.26
156 0.21
157 0.16
158 0.15
159 0.14
160 0.13
161 0.1
162 0.05
163 0.03
164 0.03
165 0.03
166 0.02
167 0.02
168 0.02
169 0.02
170 0.02
171 0.03
172 0.03
173 0.03
174 0.04
175 0.05
176 0.06
177 0.06
178 0.06
179 0.06
180 0.08
181 0.09
182 0.09
183 0.08
184 0.07
185 0.08
186 0.09
187 0.09
188 0.07
189 0.07
190 0.08
191 0.12
192 0.13
193 0.16
194 0.23
195 0.33
196 0.44
197 0.52
198 0.62
199 0.69
200 0.79
201 0.87
202 0.91
203 0.93