Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K5WSS6

Protein Details
Accession K5WSS6    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
290-314PPPAESAKAKPPKKKVRVEPAPTSVHydrophilic
NLS Segment(s)
PositionSequence
117-125APPRAPSPP
296-305AKAKPPKKKV
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 8, cyto 4
Family & Domain DBs
KEGG abp:AGABI1DRAFT134069  -  
Amino Acid Sequences MPRKAKQQPAPASTPYPSRPPLQAPPPPAHPNAARLTVSDIETMLKPEYAITGLMNLANWSLDSQENRAIMDAVRNRGIAPAVAIANAEASALAKGKVKGPSGQPTGIGAAPPAVKAPPRAPSPPPRVPTPPPPVPTRPPSPPHAPSPSASVLSSKRPIPPGSSSSGPSVAAVSVCDSEDSSMALDYEDVTTPRPASPADEEHLDSEESVEAVITLMNSAVEIFEALSASDWRTGIIEAFPTIMDGDIDRIRSVFTKKVARLQRILSPAVEAPASAADAPATRVIPWDAPPPAESAKAKPPKKKVRVEPAPTSVLGDDRTSHLTVRSSVLSHNLYCASAPAAGPQSWVPPLGLRCIHITS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.51
3 0.48
4 0.44
5 0.42
6 0.42
7 0.45
8 0.5
9 0.53
10 0.56
11 0.55
12 0.57
13 0.61
14 0.62
15 0.57
16 0.55
17 0.47
18 0.47
19 0.45
20 0.45
21 0.37
22 0.32
23 0.36
24 0.32
25 0.31
26 0.25
27 0.21
28 0.18
29 0.19
30 0.2
31 0.16
32 0.13
33 0.12
34 0.11
35 0.12
36 0.11
37 0.11
38 0.09
39 0.09
40 0.09
41 0.1
42 0.1
43 0.09
44 0.08
45 0.07
46 0.07
47 0.06
48 0.08
49 0.1
50 0.12
51 0.14
52 0.19
53 0.19
54 0.19
55 0.19
56 0.18
57 0.16
58 0.22
59 0.24
60 0.23
61 0.24
62 0.24
63 0.24
64 0.24
65 0.24
66 0.17
67 0.13
68 0.12
69 0.1
70 0.1
71 0.1
72 0.08
73 0.08
74 0.08
75 0.07
76 0.04
77 0.04
78 0.05
79 0.05
80 0.07
81 0.1
82 0.11
83 0.15
84 0.2
85 0.21
86 0.25
87 0.3
88 0.38
89 0.39
90 0.38
91 0.34
92 0.31
93 0.31
94 0.27
95 0.22
96 0.13
97 0.11
98 0.1
99 0.1
100 0.09
101 0.08
102 0.09
103 0.12
104 0.15
105 0.19
106 0.23
107 0.26
108 0.32
109 0.4
110 0.48
111 0.53
112 0.53
113 0.52
114 0.54
115 0.55
116 0.59
117 0.57
118 0.55
119 0.51
120 0.53
121 0.54
122 0.54
123 0.54
124 0.5
125 0.49
126 0.46
127 0.48
128 0.5
129 0.48
130 0.49
131 0.48
132 0.45
133 0.39
134 0.4
135 0.36
136 0.3
137 0.26
138 0.23
139 0.2
140 0.22
141 0.24
142 0.21
143 0.22
144 0.24
145 0.25
146 0.25
147 0.27
148 0.26
149 0.27
150 0.27
151 0.26
152 0.24
153 0.24
154 0.2
155 0.16
156 0.13
157 0.1
158 0.08
159 0.06
160 0.06
161 0.05
162 0.05
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.05
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.05
175 0.05
176 0.05
177 0.06
178 0.07
179 0.08
180 0.08
181 0.09
182 0.08
183 0.1
184 0.13
185 0.14
186 0.15
187 0.16
188 0.17
189 0.17
190 0.18
191 0.15
192 0.12
193 0.1
194 0.08
195 0.06
196 0.06
197 0.05
198 0.03
199 0.03
200 0.04
201 0.03
202 0.03
203 0.03
204 0.03
205 0.03
206 0.03
207 0.03
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.04
215 0.05
216 0.06
217 0.07
218 0.07
219 0.07
220 0.07
221 0.08
222 0.08
223 0.08
224 0.08
225 0.06
226 0.07
227 0.07
228 0.06
229 0.06
230 0.06
231 0.05
232 0.05
233 0.07
234 0.08
235 0.09
236 0.09
237 0.09
238 0.1
239 0.12
240 0.15
241 0.17
242 0.21
243 0.29
244 0.31
245 0.39
246 0.46
247 0.49
248 0.5
249 0.49
250 0.5
251 0.46
252 0.45
253 0.37
254 0.32
255 0.27
256 0.24
257 0.2
258 0.13
259 0.1
260 0.09
261 0.09
262 0.07
263 0.06
264 0.05
265 0.06
266 0.08
267 0.09
268 0.09
269 0.08
270 0.1
271 0.12
272 0.13
273 0.15
274 0.2
275 0.19
276 0.2
277 0.2
278 0.23
279 0.23
280 0.26
281 0.25
282 0.24
283 0.33
284 0.42
285 0.48
286 0.53
287 0.62
288 0.68
289 0.77
290 0.82
291 0.82
292 0.84
293 0.88
294 0.88
295 0.85
296 0.8
297 0.73
298 0.63
299 0.55
300 0.44
301 0.35
302 0.29
303 0.21
304 0.17
305 0.16
306 0.2
307 0.19
308 0.19
309 0.2
310 0.21
311 0.22
312 0.24
313 0.23
314 0.2
315 0.21
316 0.26
317 0.27
318 0.25
319 0.26
320 0.24
321 0.22
322 0.21
323 0.21
324 0.16
325 0.14
326 0.14
327 0.15
328 0.18
329 0.18
330 0.2
331 0.19
332 0.21
333 0.21
334 0.22
335 0.18
336 0.19
337 0.21
338 0.26
339 0.27
340 0.26